Catalog No: ARP35728_P050-HRP
Size:100ul
Price: $499.00
SKU
ARP35728_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-Med21 (ARP35728_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB, CHIP
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD
Concentration0.5 mg/ml
Blocking PeptideFor anti-Med21 (ARP35728_P050-HRP) antibody is Catalog # AAP35728
Subunit21
Gene SymbolMed21
Gene Full NameMediator complex subunit 21
Alias SymbolsSr, Sur, Srb7, Surb7, D19234, AI449604, D6Ertd782, D6Ertd782e, 0610007L03Rik
NCBI Gene Id108098
Protein NameMediator of RNA polymerase II transcription subunit 21
Description of TargetMed21 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Uniprot IDQ9CQ39
Protein Accession #NP_079591
Nucleotide Accession #NM_025315
Protein Size (# AA)144
Molecular Weight15kDa
Protein InteractionsMed21; Med6; Aagab; Med7; Mcrs1; Pik3ca; Ltb; Brd2; Nfe2;
  1. What is the species homology for "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    This target may also be called "Sr, Sur, Srb7, Surb7, D19234, AI449604, D6Ertd782, D6Ertd782e, 0610007L03Rik" in publications.

  5. What is the shipping cost for "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MED21"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MED21"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MED21"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MED21"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MED21"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MED21"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Med21 Antibody - N-terminal region : HRP (ARP35728_P050-HRP)
Your Rating
We found other products you might like!