Search Antibody, Protein, and ELISA Kit Solutions

Med21 Antibody - N-terminal region (ARP35728_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP35728_P050-FITC Conjugated

ARP35728_P050-HRP Conjugated

ARP35728_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101186 from Santa Cruz Biotechnology.
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-Med21 (ARP35728_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Med21 (ARP35728_P050) antibody is Catalog # AAP35728
Datasheets/Manuals:
Printable datasheet for anti-Med21 (ARP35728_P050) antibody
Subunit:
21
Gene Symbol:
Med21
Official Gene Full Name:
Mediator complex subunit 21
Alias Symbols:
0610007L03Rik, AI449604, D19234, D6Ertd782e, Srb7, Surb7
NCBI Gene Id:
108098
Protein Name:
Mediator of RNA polymerase II transcription subunit 21
Description of Target:
Med21 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Swissprot Id:
Q9CQ39
Protein Accession #:
NP_079591
Nucleotide Accession #:
NM_025315
Protein Size (# AA):
144
Molecular Weight:
15kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Med21.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Med21.
Protein Interactions:
Med21; Med6; Aagab; Med7; Mcrs1; Pik3ca; Ltb; Brd2; Nfe2;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...