Search Antibody, Protein, and ELISA Kit Solutions

Med19 antibody - N-terminal region (ARP55595_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55595_P050-FITC Conjugated

ARP55595_P050-HRP Conjugated

ARP55595_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mediator complex subunit 19
Protein Name:
Mediator of RNA polymerase II transcription, subunit 19 homolog (Yeast) (Predicted) EMBL EDL79310.1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
RGD1311926, Med19
Replacement Item:
This antibody may replace item sc-149350 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Med19.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Med19.
The immunogen is a synthetic peptide corresponding to a region of Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Med19 (ARP55595_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Med19 (ARP55595_P050) antibody is Catalog # AAP55595 (Previous Catalog # AAPP34308)
Printable datasheet for anti-Med19 (ARP55595_P050) antibody

Agaësse, G; Barbollat-Boutrand, L; Sulpice, E; Bhajun, R; Kharbili, ME; Berthier-Vergnes, O; Degoul, F; de la Fouchardière, A; Berger, E; Voeltzel, T; Lamartine, J; Gidrol, X; Masse, I; A large-scale RNAi screen identifies LCMR1 as a critical regulator of Tspan8-mediated melanoma invasion. 36, 446-457 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27375018

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...