Search Antibody, Protein, and ELISA Kit Solutions

MED19 Antibody - middle region (ARP55596_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55596_P050-FITC Conjugated

ARP55596_P050-HRP Conjugated

ARP55596_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-149350 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human MED19
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-MED19 (ARP55596_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED19 (ARP55596_P050) antibody is Catalog # AAP55596
Datasheets/Manuals:
Printable datasheet for anti-MED19 (ARP55596_P050) antibody
Gene Symbol:
MED19
Official Gene Full Name:
mediator complex subunit 19
Alias Symbols:
DT2P1G7, LCMR1
NCBI Gene Id:
219541
Protein Name:
Mediator of RNA polymerase II transcription subunit 19
Description of Target:
MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II .
Swissprot Id:
A0JLT2
Protein Accession #:
NP_703151
Nucleotide Accession #:
NM_153450
Protein Size (# AA):
244
Molecular Weight:
26kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED19.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED19.
Protein Interactions:
MED25; CDK19; MED6; MED13; MED12; MED26; CDK8; CCNC; MED20; MED7; MED27; MED17; MED23; MED21; MED14; MED1; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; POLR2C; POLR2B; POLR2A; MSX1; MED29; MED9; MED18; MED15; MED31; MED4; AFF4;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...