Search Antibody, Protein, and ELISA Kit Solutions

MECP2 Antibody - N-terminal region (ARP43584_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43584_T100-FITC Conjugated

ARP43584_T100-HRP Conjugated

ARP43584_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-137070 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MECP2
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 91%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%
Complete computational species homology data:
Anti-MECP2 (ARP43584_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MVAGMLGLREEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MECP2 (ARP43584_T100) antibody is Catalog # AAP43584 (Previous Catalog # AAPS13611)
Datasheets/Manuals:
Printable datasheet for anti-MECP2 (ARP43584_T100) antibody
Target Reference:
Robertson,L., (2006) Am. J. Med. Genet. B Neuropsychiatr. Genet. 141 (2), 177-183
Publications:

Jungwirth, M., Dear, M. L., Brown, P., Holbrook, K. & Goodchild, R. Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA. Hum. Mol. Genet. 19, 888-900 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat 20034025

Gene Symbol:
MECP2
Official Gene Full Name:
Methyl CpG binding protein 2 (Rett syndrome)
Alias Symbols:
AUTSX3, DKFZp686A24160, MRX16, MRX79, PPMX, RTS, RTT, RS, MRXSL, MRXS13
NCBI Gene Id:
4204
Protein Name:
Methyl-CpG-binding protein 2
Description of Target:
Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.
Swissprot Id:
P51608
Protein Accession #:
NP_004983
Nucleotide Accession #:
NM_004992
Protein Size (# AA):
486
Molecular Weight:
52kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MECP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MECP2.
Protein Interactions:
UBC; HECW2; Hipk2; SOX18; WHSC1; HPDL; XPC; CAT; HIST2H3C; HIST1H4F; HIST2H2BE; HIST2H2AC; CBX3; CBX1; SMC3; YBX1; SIN3A; CBX5; ELAVL1; SUMO2; PPARG; YY1; TERF2; SMARCA2; SOX2; SP1; SP3; LOC407840; CDKL5; PRPF40A; SMARCB1; NCOR1; SKI; HMGB1; SPI1; LBR; RB

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...