Size:100 ul
$229.00
In Stock
SKU
ARP43584_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43584_T100-FITC Conjugated

ARP43584_T100-HRP Conjugated

ARP43584_T100-Biotin Conjugated

MECP2 Antibody - N-terminal region (ARP43584_T100)

Catalog#: ARP43584_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-137070 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MECP2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 91%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%
Complete computational species homology dataAnti-MECP2 (ARP43584_T100)
Peptide SequenceSynthetic peptide located within the following region: MVAGMLGLREEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MECP2 (ARP43584_T100) antibody is Catalog # AAP43584 (Previous Catalog # AAPS13611)
Datasheets/ManualsPrintable datasheet for anti-MECP2 (ARP43584_T100) antibody
Target ReferenceRobertson,L., (2006) Am. J. Med. Genet. B Neuropsychiatr. Genet. 141 (2), 177-183
Publications

Jungwirth, M., Dear, M. L., Brown, P., Holbrook, K. & Goodchild, R. Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA. Hum. Mol. Genet. 19, 888-900 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat 20034025

Gene SymbolMECP2
Official Gene Full NameMethyl CpG binding protein 2 (Rett syndrome)
Alias SymbolsAUTSX3, DKFZp686A24160, MRX16, MRX79, PPMX, RTS, RTT, RS, MRXSL, MRXS13
NCBI Gene Id4204
Protein NameMethyl-CpG-binding protein 2
Description of TargetHuman proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.
Swissprot IdP51608
Protein Accession #NP_004983
Nucleotide Accession #NM_004992
Protein Size (# AA)486
Molecular Weight52kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MECP2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MECP2.
Protein InteractionsUBC; HECW2; Hipk2; SOX18; WHSC1; HPDL; XPC; CAT; HIST2H3C; HIST1H4F; HIST2H2BE; HIST2H2AC; CBX3; CBX1; SMC3; YBX1; SIN3A; CBX5; ELAVL1; SUMO2; PPARG; YY1; TERF2; SMARCA2; SOX2; SP1; SP3; LOC407840; CDKL5; PRPF40A; SMARCB1; NCOR1; SKI; HMGB1; SPI1; LBR; RB
Write Your Own Review
You're reviewing:MECP2 Antibody - N-terminal region (ARP43584_T100)
Your Rating
Aviva Pathways
Aviva Tips and Tricks
Aviva Live Chat
Assay Development