- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for ME2 Antibody (OAAF07926) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ME2. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen. |
| Peptide Sequence | Synthetic peptide located within the following region: VCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNT |
| Concentration | 1mg/ml |
| Specificity | ME2 Antibody detects endogenous levels of total ME2 protein. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | WB: 1:500~1:1000 IHC: 1:50~1:100 ELISA: 1:40000 |
| Gene Symbol | ME2 |
|---|---|
| Gene Full Name | malic enzyme 2 |
| Alias Symbols | malate dehydrogenase (oxaloacetate-decarboxylating);Malic enzyme 2;malic enzyme 2, NAD(+)-dependent, mitochondrial;NAD-dependent malic enzyme, mitochondrial;NAD-ME;ODS1;pyruvic-malic carboxylase. |
| NCBI Gene Id | 4200 |
| Protein Name | NAD-dependent malic enzyme, mitochondrial |
| Uniprot ID | P23368 |
| Molecular Weight | 65 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "ME2 Antibody (OAAF07926)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "ME2 Antibody (OAAF07926)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "ME2 Antibody (OAAF07926)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "ME2 Antibody (OAAF07926)"?
This target may also be called "malate dehydrogenase (oxaloacetate-decarboxylating);Malic enzyme 2;malic enzyme 2, NAD(+)-dependent, mitochondrial;NAD-dependent malic enzyme, mitochondrial;NAD-ME;ODS1;pyruvic-malic carboxylase." in publications.
-
What is the shipping cost for "ME2 Antibody (OAAF07926)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "ME2 Antibody (OAAF07926)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "ME2 Antibody (OAAF07926)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "65 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "ME2 Antibody (OAAF07926)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "ME2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "ME2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "ME2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "ME2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "ME2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "ME2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
