Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP32794_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32794_P050-FITC Conjugated

ARP32794_P050-HRP Conjugated

ARP32794_P050-Biotin Conjugated

ME1 Antibody - N-terminal region (ARP32794_P050)

Catalog#: ARP32794_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100569, HPA006493
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ME1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 100%; Rat: 100%; Sheep: 92%
Complete computational species homology data Anti-ME1 (ARP32794_P050)
Peptide Sequence Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ME1 (ARP32794_P050) antibody is Catalog # AAP32794 (Previous Catalog # AAPP03813)
Datasheets/Manuals Printable datasheet for anti-ME1 (ARP32794_P050) antibody
Sample Type Confirmation

ME1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Hsieh,J.Y., (2006) J. Biol. Chem. 281 (32), 23237-23245
Gene Symbol ME1
Official Gene Full Name Malic enzyme 1, NADP(+)-dependent, cytosolic
Alias Symbols HUMNDME, MES
NCBI Gene Id 4199
Protein Name NADP-dependent malic enzyme
Description of Target ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P48163
Protein Accession # NP_002386
Nucleotide Accession # NM_002395
Protein Size (# AA) 572
Molecular Weight 64kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ME1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ME1.
Protein Interactions UBC; VTA1; RPUSD2; GORASP2; BOP1; TOM1; NMI; CUL3; UGDH; TBCD; GTF2A1; GARS; CTTN;
  1. What is the species homology for "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep".

  2. How long will it take to receive "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ME1 Antibody - N-terminal region (ARP32794_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    This target may also be called "HUMNDME, MES" in publications.

  5. What is the shipping cost for "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "64kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ME1 Antibody - N-terminal region (ARP32794_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ME1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ME1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ME1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ME1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ME1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ME1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ME1 Antibody - N-terminal region (ARP32794_P050)
Your Rating
We found other products you might like!