Search Antibody, Protein, and ELISA Kit Solutions

ME1 Antibody - N-terminal region (ARP32794_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP32794_P050-FITC Conjugated

ARP32794_P050-HRP Conjugated

ARP32794_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-100569, HPA006493
The immunogen is a synthetic peptide directed towards the N terminal region of human ME1
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 91%; Rabbit: 100%; Rat: 100%; Sheep: 92%
Complete computational species homology data:
Anti-ME1 (ARP32794_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ME1 (ARP32794_P050) antibody is Catalog # AAP32794 (Previous Catalog # AAPP03813)
Printable datasheet for anti-ME1 (ARP32794_P050) antibody
Sample Type Confirmation:

ME1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Hsieh,J.Y., (2006) J. Biol. Chem. 281 (32), 23237-23245
Gene Symbol:
Official Gene Full Name:
Malic enzyme 1, NADP(+)-dependent, cytosolic
Alias Symbols:
NCBI Gene Id:
Protein Name:
NADP-dependent malic enzyme
Description of Target:
ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ME1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ME1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...