Search Antibody, Protein, and ELISA Kit Solutions

ME1 Antibody - C-terminal region (ARP32795_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32795_P050-FITC Conjugated

ARP32795_P050-HRP Conjugated

ARP32795_P050-Biotin Conjugated

Gene Symbol:
ME1
Official Gene Full Name:
malic enzyme 1, NADP(+)-dependent, cytosolic
NCBI Gene Id:
4199
Protein Name:
NADP-dependent malic enzyme
Swissprot Id:
P48163
Protein Accession #:
NP_002386.1
Nucleotide Accession #:
NM_002395.5
Alias Symbols:
MES, HUMNDME
Replacement Item:
This antibody may replace item sc-100569 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.
Protein Size (# AA):
406
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ME1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ME1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of human ME1
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 92%; Goat: 85%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 100%; Sheep: 85%
Complete computational species homology data:
Anti-ME1 (ARP32795_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-ME1 (ARP32795_P050) antibody is Catalog # AAP32795
Datasheets/Manuals:
Printable datasheet for anti-ME1 (ARP32795_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...