MDR1 Recombinant Protein (Entamoeba histolytica) (OPCA02577)

Catalog No: OPCA02577

MDR1 Recombinant Protein (Entamoeba histolytica) (OPCA02577) in SDS-PAGE showing the molecular weight of approximately 14.49 kDa.

Product Info

• Predicted Species Reactivity: Entamoeba histolytica
• Product Format: Liquid or Lyophilized powder
• Host: Entamoeba histolytica
• Additional Information: Relevance: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
• Protein Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-114 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Emetine-resistant mutants of Entamoeba histolytica overexpress mRNAs for multidrug resistance.Samuelson J., Ayala P., Orozco E., Wirth D.Mol. Biochem. Parasitol. 38:281-290(1990)
• Gene Symbol: MDR1
• Alias Symbols: P-glycoprotein.
• Protein Name: Multidrug resistance protein 1
• Description of Target: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
• Uniprot ID: P16875
• Protein Size (# AA): Recombinant
• Molecular Weight: 14.5 kda