Catalog No: AVARP06007_T100
Price: $0.00
SKU
AVARP06007_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MDM4 (AVARP06007_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MDM4
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 80%; Dog: 93%; Horse: 93%; Human: 100%; Pig: 86%; Rabbit: 80%
Peptide SequenceSynthetic peptide located within the following region: MLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQSAEESSTSRKRT
Concentration1.0 mg/ml
Blocking PeptideFor anti-MDM4 (AVARP06007_T100) antibody is Catalog # AAP30507 (Previous Catalog # AAPP01143)
ReferenceGilkes,D.M., (2008) Mol. Cell. Biol. 28 (6), 1999-2010
Description
Gene SymbolMDM4
Gene Full NameMdm4 p53 binding protein homolog (mouse)
Alias SymbolsHDMX, MDMX, MRP1, BMFS6
NCBI Gene Id4194
Protein NameProtein Mdm4
Description of TargetMDM4 inhibits p53- and p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. inhibits degradation of MDM2. It can reverse MDM2-targeted degradation of p53 while maintaining suppression of p53 transactivation and apoptotic functions.The human MDM4 gene, which plays a role in apoptosis, encodes a 490-amino acid protein containing a RING finger domain and a putative nuclear localization signal. The MDM4 putative nuclear localization signal, which all Mdm proteins contain, is located in the C-terminal region of the protein. The mRNA is expressed at a high level in thymus and at lower levels in all other tissues tested. MDM4 protein produced by in vitro translation interacts with p53 via a binding domain located in the N-terminal region of the MDM4 protein. MDM4 shows significant structural similarity to p53-binding protein MDM2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO15151
Protein Accession #NP_002384
Nucleotide Accession #NM_002393
Protein Size (# AA)490
Molecular Weight55kDa
Protein InteractionsRNF115; CAPN7; CD160; MDM2; TP53; UBC; MDM4; USP2; YWHAG; UBE2D2; PRKAA1; BCL2; RPS20; RPS15; RPL37; YWHAQ; HSP90AA1; CSNK1A1; PPP1CC; PPP1CB; PPP1CA; RB1; APP; UBE2D3; UBE2D1; MNAT1; ABL1; LRSAM1; TRIM55; TRIM46; MKRN3; YWHAZ; YWHAE; YWHAB; CDKN1A; RFWD2
  1. What is the species homology for "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MDM4 Antibody - N-terminal region (AVARP06007_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    This target may also be called "HDMX, MDMX, MRP1, BMFS6" in publications.

  5. What is the shipping cost for "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MDM4 Antibody - N-terminal region (AVARP06007_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MDM4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MDM4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MDM4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MDM4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MDM4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MDM4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MDM4 Antibody - N-terminal region (AVARP06007_T100)
Your Rating
We found other products you might like!