Search Antibody, Protein, and ELISA Kit Solutions

MDM2 Antibody - middle region : FITC (ARP74981_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74981_P050 Unconjugated

ARP74981_P050-HRP Conjugated

ARP74981_P050-Biotin Conjugated

Gene Symbol:
MDM2
NCBI Gene Id:
4193
Swissprot Id:
Q00987-9
Alias Symbols:
MDM2,
Replacement Item:
This antibody may replace item sc-13161 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
Protein Size (# AA):
446
Molecular Weight:
49kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MDM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MDM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human MDM2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
RPS7; RPS6; RPL26; UBE2D3; UBE2D2; UBE2D1; UBC; CDKN2A; HDAC1; TSC22D3; DAPK3; PARP1; PML; ARIH2; RPL23; KAT2B; AATF; RCHY1; DLAT; DHX9; DDX5; DAXX; U19; HRNR; OGDH; NCL; HNRNPM; MDM4; MDM2; ILF3; IFI16; IARS; HSP90AB1; HSP90AA1; HSPA8; HNRNPU; GTF2I; PER
Blocking Peptide:
For anti-MDM2 (ARP74981_P050-FITC) antibody is Catalog # AAP74981
Datasheets/Manuals:
Printable datasheet for anti-MDM2 (ARP74981_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...