Size:100 ul
$289.00
In Stock
SKU
ARP74981_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74981_P050 Unconjugated

ARP74981_P050-HRP Conjugated

ARP74981_P050-Biotin Conjugated

MDM2 Antibody - middle region : FITC (ARP74981_P050-FITC)

Catalog#: ARP74981_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-13161 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human MDM2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: EISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKA
Concentration0.5 mg/ml
Blocking PeptideFor anti-MDM2 (ARP74981_P050-FITC) antibody is Catalog # AAP74981
Datasheets/ManualsPrintable datasheet for anti-MDM2 (ARP74981_P050-FITC) antibody
Target ReferenceN/A
Gene SymbolMDM2
Alias SymbolsMDM2,
NCBI Gene Id4193
Description of TargetThis gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
Swissprot IdQ00987-9
Protein Size (# AA)446
Molecular Weight49kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MDM2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MDM2.
Protein InteractionsRPS7; RPS6; RPL26; UBE2D3; UBE2D2; UBE2D1; UBC; CDKN2A; HDAC1; TSC22D3; DAPK3; PARP1; PML; ARIH2; RPL23; KAT2B; AATF; RCHY1; DLAT; DHX9; DDX5; DAXX; U19; HRNR; OGDH; NCL; HNRNPM; MDM4; MDM2; ILF3; IFI16; IARS; HSP90AB1; HSP90AA1; HSPA8; HNRNPU; GTF2I; PER
Write Your Own Review
You're reviewing:MDM2 Antibody - middle region : FITC (ARP74981_P050-FITC)
Your Rating
Aviva ChIP Antibodies
Aviva Validation Data
Assay Development
Aviva HIS tag Deal