Search Antibody, Protein, and ELISA Kit Solutions

MDH2 Antibody - C-terminal region (ARP48286_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48286_T100-FITC Conjugated

ARP48286_T100-HRP Conjugated

ARP48286_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-133777 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human MDH2
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-MDH2 (ARP48286_T100)
Peptide Sequence:
Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MDH2 (ARP48286_T100) antibody is Catalog # AAP48286 (Previous Catalog # AAPY01655)
Printable datasheet for anti-MDH2 (ARP48286_T100) antibody
Target Reference:
Rzem,R., (2007) J. Inherit. Metab. Dis. 30 (5), 681-689

Freund, D. M., Prenni, J. E. & Curthoys, N. P. Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis. Am. J. Physiol. Renal Physiol. 304, F145-55 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23136003

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

Gene Symbol:
Official Gene Full Name:
Malate dehydrogenase 2, NAD (mitochondrial)
Alias Symbols:
M-MDH, MDH, MGC:3559, MOR1
NCBI Gene Id:
Protein Name:
Malate dehydrogenase, mitochondrial
Description of Target:
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MDH2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MDH2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...