Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MDH2 antibody - C-terminal region (ARP48286_T100)

100 ul
$229.00
In Stock

Conjugation Options

ARP48286_T100-FITC Conjugated

ARP48286_T100-HRP Conjugated

ARP48286_T100-Biotin Conjugated

Gene Symbol:
MDH2
NCBI Gene Id:
4191
Official Gene Full Name:
Malate dehydrogenase 2, NAD (mitochondrial)
Protein Name:
Malate dehydrogenase, mitochondrial
Swissprot Id:
P40926
Protein Accession #:
NP_005909
Nucleotide Accession #:
NM_005918
Alias Symbols:
M-MDH, MDH, MGC:3559, MOR1
Replacement Item:
This antibody may replace item sc-133777 from Santa Cruz Biotechnology.
Description of Target:
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
338
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MDH2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MDH2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MDH2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-MDH2 (ARP48286_T100)
Peptide Sequence:
Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FUS; HUWE1; GRSF1; UBC; MDM2; PARK2; UBD; METTL21B; VCAM1; ITGA4; FN1; ATF2; LDHAL6A; MRPS28; IDH1; CLNS1A; SERPINH1; ATP5B; ATP5A1; CRYAB; COPS5; CDK2; PSMA3; PCNA; HDAC5; Mapk13; PSMD4; PC; WARS; NDUFS1; MDH2; GOT2; FH; CS;
Blocking Peptide:
For anti-MDH2 (ARP48286_T100) antibody is Catalog # AAP48286 (Previous Catalog # AAPY01655)
Datasheets/Manuals:
Printable datasheet for anti-MDH2 (ARP48286_T100) antibody
Target Reference:
Rzem,R., (2007) J. Inherit. Metab. Dis. 30 (5), 681-689
Publications:

Freund, D. M., Prenni, J. E. & Curthoys, N. P. Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis. Am. J. Physiol. Renal Physiol. 304, F145-55 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23136003

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

Tell us what you think about this item!

Write A Review
    Please, wait...