Search Antibody, Protein, and ELISA Kit Solutions

MDH1 Antibody - middle region (ARP48284_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48284_T100-FITC Conjugated

ARP48284_T100-HRP Conjugated

ARP48284_T100-Biotin Conjugated

Gene Symbol:
MDH1
Official Gene Full Name:
Malate dehydrogenase 1, NAD (soluble)
NCBI Gene Id:
4190
Protein Name:
Malate dehydrogenase, cytoplasmic
Swissprot Id:
P40925
Protein Accession #:
NP_005908
Nucleotide Accession #:
NM_005917
Alias Symbols:
MDH-s, MDHA, MGC:1375, MOR2
Replacement Item:
This antibody may replace item sc-101516 from Santa Cruz Biotechnology.
Description of Target:
Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
334
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MDH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MDH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MDH1
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-MDH1 (ARP48284_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ISG15; UBC; NEDD8; PARK2; HSP90AB1; HSP90AA1; FUS; IQCB1; SDHA; PGM1; LDHA; ESD; Htt; PRDX5; PRDX6; SLC9A3R1; AKT1; TERF2IP; TERF1; TP53; EGFR; MPP3; MDH1; GPD1;
Blocking Peptide:
For anti-MDH1 (ARP48284_T100) antibody is Catalog # AAP48284 (Previous Catalog # AAPY01653)
Datasheets/Manuals:
Printable datasheet for anti-MDH1 (ARP48284_T100) antibody
Target Reference:
Hillier,L.W., (2005) Nature 434 (7034), 724-731
Publications:

Nussbaumer, M; Asara, JM; Teplytska, L; Murphy, MP; Logan, A; Turck, CW; Filiou, MD; Selective Mitochondrial Targeting Exerts Anxiolytic Effects In Vivo. 41, 1751-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26567514

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...