MDH1 Antibody - middle region (ARP48284_T100)

Catalog#: ARP48284_T100

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-101516 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MDH1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MDH1 (ARP48284_T100) antibody is Catalog # AAP48284 (Previous Catalog # AAPY01653)
• Target Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Publications:

  Nussbaumer, M; Asara, JM; Teplytska, L; Murphy, MP; Logan, A; Turck, CW; Filiou, MD; Selective Mitochondrial Targeting Exerts Anxiolytic Effects In Vivo. 41, 1751-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26567514

  Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

• Gene Symbol: MDH1
• Official Gene Full Name: Malate dehydrogenase 1, NAD (soluble)
• Alias Symbols: MDH-s, MDHA, MGC:1375, MOR2
• NCBI Gene Id: 4190
• Protein Name: Malate dehydrogenase, cytoplasmic
• Description of Target: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Swissprot Id: P40925
• Protein Accession #: NP_005908
• Nucleotide Accession #: NM_005917
• Protein Size (# AA): 334
• Molecular Weight: 36kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MDH1.
• Protein Interactions: ISG15; UBC; NEDD8; PARK2; HSP90AB1; HSP90AA1; FUS; IQCB1; SDHA; PGM1; LDHA; ESD; Htt; PRDX5; PRDX6; SLC9A3R1; AKT1; TERF2IP; TERF1; TP53; EGFR; MPP3; MDH1; GPD1;

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: MDH1 antibody tested with Human Jurkat Cells (ARP48284_T100)