MDH1 Antibody - middle region (ARP48284_T100)

Size:100 ul

Human Jurkat

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-101516 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MDH1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Complete computational species homology data: Anti-MDH1 (ARP48284_T100)
• Peptide Sequence: Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MDH1 (ARP48284_T100) antibody is Catalog # AAP48284 (Previous Catalog # AAPY01653)
• Datasheets/Manuals: Printable datasheet for anti-MDH1 (ARP48284_T100) antibody
• Target Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Publications:

  Nussbaumer, M; Asara, JM; Teplytska, L; Murphy, MP; Logan, A; Turck, CW; Filiou, MD; Selective Mitochondrial Targeting Exerts Anxiolytic Effects In Vivo. 41, 1751-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26567514

  Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

Target Info

• Gene Symbol: MDH1
• Official Gene Full Name: Malate dehydrogenase 1, NAD (soluble)
• Alias Symbols: MDH-s, MDHA, MGC:1375, MOR2
• NCBI Gene Id: 4190
• Protein Name: Malate dehydrogenase, cytoplasmic
• Description of Target: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Swissprot Id: P40925
• Protein Accession #: NP_005908
• Nucleotide Accession #: NM_005917
• Protein Size (# AA): 334
• Molecular Weight: 36kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express MDH1.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MDH1.
• Protein Interactions: ISG15; UBC; NEDD8; PARK2; HSP90AB1; HSP90AA1; FUS; IQCB1; SDHA; PGM1; LDHA; ESD; Htt; PRDX5; PRDX6; SLC9A3R1; AKT1; TERF2IP; TERF1; TP53; EGFR; MPP3; MDH1; GPD1;