Size:100 ul
$229.00
In stock
SKU
ARP48284_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48284_T100-FITC Conjugated

ARP48284_T100-HRP Conjugated

ARP48284_T100-Biotin Conjugated

MDH1 Antibody - middle region (ARP48284_T100)

Catalog#: ARP48284_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101516 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MDH1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data Anti-MDH1 (ARP48284_T100)
Peptide Sequence Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MDH1 (ARP48284_T100) antibody is Catalog # AAP48284 (Previous Catalog # AAPY01653)
Datasheets/Manuals Printable datasheet for anti-MDH1 (ARP48284_T100) antibody
Target Reference Hillier,L.W., (2005) Nature 434 (7034), 724-731
Publications

Nussbaumer, M; Asara, JM; Teplytska, L; Murphy, MP; Logan, A; Turck, CW; Filiou, MD; Selective Mitochondrial Targeting Exerts Anxiolytic Effects In Vivo. 41, 1751-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26567514

Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

Gene Symbol MDH1
Official Gene Full Name Malate dehydrogenase 1, NAD (soluble)
Alias Symbols MDH-s, MDHA, MGC:1375, MOR2
NCBI Gene Id 4190
Protein Name Malate dehydrogenase, cytoplasmic
Description of Target Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P40925
Protein Accession # NP_005908
Nucleotide Accession # NM_005917
Protein Size (# AA) 334
Molecular Weight 36kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MDH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MDH1.
Protein Interactions ISG15; UBC; NEDD8; PARK2; HSP90AB1; HSP90AA1; FUS; IQCB1; SDHA; PGM1; LDHA; ESD; Htt; PRDX5; PRDX6; SLC9A3R1; AKT1; TERF2IP; TERF1; TP53; EGFR; MPP3; MDH1; GPD1;
Write Your Own Review
You're reviewing:MDH1 Antibody - middle region (ARP48284_T100)
Your Rating