MDH1 Antibody - middle region (ARP48284_T100)

Catalog#: ARP48284_T100

• Size: 100 ul

• Gene Symbol: MDH1
• Official Gene Full Name: Malate dehydrogenase 1, NAD (soluble)
• NCBI Gene Id: 4190
• Protein Name: Malate dehydrogenase, cytoplasmic
• Swissprot Id: P40925
• Protein Accession #: NP_005908
• Nucleotide Accession #: NM_005917
• Alias Symbols: MDH-s, MDHA, MGC:1375, MOR2
• Replacement Item: This antibody may replace item sc-101516 from Santa Cruz Biotechnology.
• Description of Target: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Size (# AA): 334
• Molecular Weight: 36kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Protein A purified
• Application: WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MDH1.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MDH1
• Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: ISG15; UBC; NEDD8; PARK2; HSP90AB1; HSP90AA1; FUS; IQCB1; SDHA; PGM1; LDHA; ESD; Htt; PRDX5; PRDX6; SLC9A3R1; AKT1; TERF2IP; TERF1; TP53; EGFR; MPP3; MDH1; GPD1;
• Blocking Peptide: For anti-MDH1 (ARP48284_T100) antibody is Catalog # AAP48284 (Previous Catalog # AAPY01653)
• Target Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Publications:

  Nussbaumer, M; Asara, JM; Teplytska, L; Murphy, MP; Logan, A; Turck, CW; Filiou, MD; Selective Mitochondrial Targeting Exerts Anxiolytic Effects In Vivo. 41, 1751-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26567514

  Povlsen, J. A. et al. Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One 8, e64093 (2013). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23704975

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: MDH1 antibody tested with Human Jurkat Cells (ARP48284_T100)