MDC1 Antibody - C-terminal region (ARP36798_P050)

Catalog No: ARP36798_P050

WB Suggested Anti-MDC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysateMDC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MDC1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 92%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GKEEDVVTPKPGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MDC1 (ARP36798_P050) antibody is Catalog # AAP36798 (Previous Catalog # AAPP08672)
• Sample Type Confirmation:

  MDC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Info

• Gene Symbol: MDC1
• Gene Full Name: Mediator of DNA-damage checkpoint 1
• Alias Symbols: NFBD1
• NCBI Gene Id: 9656
• Protein Name: Mediator of DNA damage checkpoint protein 1
• Description of Target: The protein encoded by this gene contains an N-terminal forkhead domain, two BRCA1 C-terminal (BRCT) motifs and a central domain with 13 repetitions of an approximately 41-amino acid sequence. The encoded protein is required to activate the intra-S phase and G2/M phase cell cycle checkpoints in response to DNA damage. This nuclear protein interacts with phosphorylated histone H2AX near sites of DNA double-strand breaks through its BRCT motifs, and facilitates recruitment of the ATM kinase and meiotic recombination 11 protein complex to DNA damage foci.
• Uniprot ID: Q14676
• Protein Accession #: NP_055456
• Nucleotide Accession #: NM_014641
• Protein Size (# AA): 2089
• Molecular Weight: 227kDa
• Protein Interactions: RPA3; RPA2; RPA1; EED; TOPBP1; RNF8; UBC; LMNA; RAG1; CDC27; NCL; NBN; MRE11A; CSNK2A1; RAD50; CAPZB; CAPZA1; AUP1; ATP2A2; LOC729324; CHAMP1; HNRNPUL2; PGAM5; LSM12; ANAPC16; OSBPL8; DTX2; ZNF251; RBM17; FAM175A; LAS1L; LPCAT1; MYH14; SLC25A22; ZNF768; H