Search Antibody, Protein, and ELISA Kit Solutions

MCU Antibody - C-terminal region (ARP94180_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MCU
Official Gene Full Name:
mitochondrial calcium uniporter
NCBI Gene Id:
215999
Protein Name:
calcium uniporter protein, mitochondrial
Swissprot Id:
Q3UMR5-2
Protein Accession #:
NP_001028431.2
Nucleotide Accession #:
NM_001033259.4
Alias Symbols:
Gm64, AV064928, C10orf42, Ccdc109a, 2010012O16Rik, D130073L02Rik
Protein Size (# AA):
201
Molecular Weight:
24 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MCU.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MCU.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse CCDC109A
Predicted Species Reactivity:
Mouse
Tested Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: YPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MCU (ARP94180_P050) antibody is Catalog # AAP94180
Datasheets/Manuals:
Printable datasheet for anti-MCU (ARP94180_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...