SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP40751_P050
Price: $0.00
SKU
ARP40751_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MCTS1 (ARP40751_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MCTS1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV
Concentration0.5 mg/ml
Blocking PeptideFor anti-MCTS1 (ARP40751_P050) antibody is Catalog # AAP40751 (Previous Catalog # AAPY01003)
Sample Type Confirmation

MCTS1 is supported by BioGPS gene expression data to be expressed in COLO205

ReferenceShi,B., (2003) J. Cell. Biochem. 90 (1), 68-79
Gene SymbolMCTS1
Gene Full NameMalignant T cell amplified sequence 1
Alias SymbolsMCT1, MCT-1
NCBI Gene Id28985
Protein NameMalignant T-cell-amplified sequence 1
Description of TargetMCTS1 is an anti-oncogene that play a role in cell cycle regulation; decreases cell doubling time and anchorage-dependent growth; shortens the duration of G1 transit time and G1/S transition. When constituvely expressed, MCTS1 increases CDK4 and CDK6 kinases activity and CCND1/cyclin D1 protein level, as well as G1 cyclin/CDK complex formation. MCTS1 plays a role as translation enhancer; and recruits the density-regulated protein/DENR and binds to the cap complex of the 5'-terminus of mRNAs, subsequently altering the mRNA translation profile; MCTS1 up-regulates protein levels of BCL2L2, TFDP1, MRE11A, CCND1 and E2F1, while mRNA levels remains constant. MCTS1 hyperactivates DNA damage signaling pathway; increased gamma-irradiation-induced phosphorylation of histone H2AX, and induces damage foci formation. MCTS1 increases the overall number of chromosomal abnormalities such as larger chromosomes formation and multiples chromosomal fusions when over-expressed in gamma-irradiated cells. MCTS1 may play a role in promoting lymphoid tumor development: lymphoid cell lines over-expressing MCTS1 exhibit increased growth rates and display increased protection against apoptosis. MCTS1 may contribute to the pathogenesis and progression of breast cancer via promotion of angiogenesis through the decline of inhibitory THBS1/thrombospondin-1, and inhibition of apoptosis. MCTS1 is involved in the process of proteosome degradation to down-regulate Tumor suppressor p53/TP53 in breast cancer cell; MCTS1 positively regulates phosphorylation of MAPK1 and MAPK3.
Uniprot IDQ9ULC4
Protein Accession #NP_054779
Nucleotide Accession #NM_014060
Protein Size (# AA)181
Molecular Weight20kDa
Protein InteractionsASB6; IPO9; OGFOD1; STK26; UBXN1; ISOC1; TWF2; PROSC; TUBB4B; PDCD6IP; NAE1; USP5; YWHAE; UBA1; PTMA; TWF1; MYO1E; IPO5; HMGB3; HDGF; DHX15; ATIC; UBC; DENR; SUMO1;
  1. What is the species homology for "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MCTS1 Antibody - N-terminal region (ARP40751_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    This target may also be called "MCT1, MCT-1" in publications.

  5. What is the shipping cost for "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MCTS1 Antibody - N-terminal region (ARP40751_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MCTS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCTS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCTS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCTS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCTS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCTS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MCTS1 Antibody - N-terminal region (ARP40751_P050)
Your Rating
We found other products you might like!