MCMBP Antibody - N-terminal region (ARP70846_P050)

Catalog No: ARP70846_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: MCMBP
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/mlMCMBP is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MCMBP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: SYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MCMBP (ARP70846_P050) antibody is Catalog # AAP70846
• Sample Type Confirmation:

  MCMBP is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: MCMBP
• Alias Symbols: MCM-BP, C10orf119
• NCBI Gene Id: 79892
• Protein Name: Mini-chromosome maintenance complex-binding protein
• Description of Target: This gene encodes a protein which is a component of the hexameric minichromosome maintenance (MCM) complex which regulates initiation and elongation of DNA. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9BTE3
• Protein Accession #: NP_079110
• Nucleotide Accession #: NM_024834
• Protein Size (# AA): 642
• Molecular Weight: 72kDa
• Protein Interactions: PRTFDC1; MCM7; MCM9; MCM8; KEAP1; MCM6; MCM5; MCM4; MCM3; MCM2; FKBP5; UBC; RPRD1A; XPOT; USP7; UBD; CUL3; SUMO2; TECPR1; DDIT3;