MCM7 Antibody - N-terminal region (ARP36693_P050)

Size:100 ul

Human Thyroid Tumor

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-173959 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MCM7
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MCM7 (ARP36693_P050) antibody is Catalog # AAP36693
• Datasheets/Manuals: Printable datasheet for anti-MCM7 (ARP36693_P050) antibody

Target Info

• Gene Symbol: MCM7
• Official Gene Full Name: minichromosome maintenance complex component 7
• Alias Symbols: CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146
• NCBI Gene Id: 4176
• Protein Name: DNA replication licensing factor MCM7
• Description of Target: MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.
• Swissprot Id: P33993-2
• Protein Accession #: NP_877577
• Nucleotide Accession #: NM_182776
• Protein Size (# AA): 389
• Molecular Weight: 42kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express MCM7.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MCM7.
• Protein Interactions: AK8; MIPOL1; C8orf34; USHBP1; MCMBP; CCDC102B; TRIM54; MBIP; UBQLN1; TRIM27; NAB2; KIFC3; GOLGA2; PNMA1; UBC; SP2; HAUS2; CEP250; CEP57; SUMO2; SUMO3; PCNA; STAU1; SUZ12; RNF2; MCM4; MCM2; HSP90AB1; PRMT1; PRRC1; CLUH; TOMM34; TRIM16; HYOU1; BAG3; MIB1; P