Search Antibody, Protein, and ELISA Kit Solutions

MCM7 Antibody - N-terminal region (ARP36693_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36693_P050-FITC Conjugated

ARP36693_P050-HRP Conjugated

ARP36693_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MCM7
Official Gene Full Name:
minichromosome maintenance complex component 7
NCBI Gene Id:
4176
Protein Name:
DNA replication licensing factor MCM7
Swissprot Id:
P33993-2
Protein Accession #:
NP_877577
Nucleotide Accession #:
NM_182776
Alias Symbols:
CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146
Replacement Item:
This antibody may replace item sc-173959 from Santa Cruz Biotechnology.
Description of Target:
MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.
Protein Size (# AA):
389
Molecular Weight:
42kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MCM7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MCM7.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MCM7
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide Sequence:
Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AK8; MIPOL1; C8orf34; USHBP1; MCMBP; CCDC102B; TRIM54; MBIP; UBQLN1; TRIM27; NAB2; KIFC3; GOLGA2; PNMA1; UBC; SP2; HAUS2; CEP250; CEP57; SUMO2; SUMO3; PCNA; STAU1; SUZ12; RNF2; MCM4; MCM2; HSP90AB1; PRMT1; PRRC1; CLUH; TOMM34; TRIM16; HYOU1; BAG3; MIB1; P
Blocking Peptide:
For anti-MCM7 (ARP36693_P050) antibody is Catalog # AAP36693
Datasheets/Manuals:
Printable datasheet for anti-MCM7 (ARP36693_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...