Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP36693_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36693_P050-FITC Conjugated

ARP36693_P050-HRP Conjugated

ARP36693_P050-Biotin Conjugated

MCM7 Antibody - N-terminal region (ARP36693_P050)

Catalog#: ARP36693_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-173959 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human MCM7
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide Sequence Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MCM7 (ARP36693_P050) antibody is Catalog # AAP36693
Datasheets/Manuals Printable datasheet for anti-MCM7 (ARP36693_P050) antibody
Gene Symbol MCM7
Official Gene Full Name minichromosome maintenance complex component 7
Alias Symbols CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146
NCBI Gene Id 4176
Protein Name DNA replication licensing factor MCM7
Description of Target MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.
Swissprot Id P33993-2
Protein Accession # NP_877577
Nucleotide Accession # NM_182776
Protein Size (# AA) 389
Molecular Weight 42kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MCM7.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MCM7.
Protein Interactions AK8; MIPOL1; C8orf34; USHBP1; MCMBP; CCDC102B; TRIM54; MBIP; UBQLN1; TRIM27; NAB2; KIFC3; GOLGA2; PNMA1; UBC; SP2; HAUS2; CEP250; CEP57; SUMO2; SUMO3; PCNA; STAU1; SUZ12; RNF2; MCM4; MCM2; HSP90AB1; PRMT1; PRRC1; CLUH; TOMM34; TRIM16; HYOU1; BAG3; MIB1; P
  1. What is the species homology for "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MCM7 Antibody - N-terminal region (ARP36693_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    This target may also be called "CDC47, MCM2, P1.1-MCM3, P1CDC47, P85MCM, PNAS146" in publications.

  5. What is the shipping cost for "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MCM7 Antibody - N-terminal region (ARP36693_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MCM7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCM7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCM7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCM7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCM7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCM7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MCM7 Antibody - N-terminal region (ARP36693_P050)
Your Rating
We found other products you might like!