Catalog No: OAAF08077
Size:100 ug
Price: $344.00
SKU
OAAF08077
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for MCM6 Antibody (OAAF08077)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLiquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Western blot
Reconstitution and StorageStore at -20°C for 1 year.
ImmunogenThe antiserum was produced against synthesized peptide derived from the Internal region of human MCM6. AA range:331-380
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: VKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGVLLMLFGGVPKTT
Concentration1 mg/ml
SpecificityMCM6 Antibody detects endogenous levels of MCM6 protein.
Application InfoWB: 1/500 - 1/2000
ELISA: 1/20000
Gene SymbolMCM6
Gene Full Nameminichromosome maintenance complex component 6
Alias SymbolsDNA replication licensing factor MCM6;MCG40308;MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe);minichromosome maintenance deficient (mis5, S. pombe) 6;Mis5;P105MCM.
NCBI Gene Id4175
Protein NameDNA replication licensing factor MCM6
Description of TargetActs as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Uniprot IDQ14566
Molecular Weight92 kDa
  1. What is the species homology for "MCM6 Antibody (OAAF08077)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "MCM6 Antibody (OAAF08077)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "MCM6 Antibody (OAAF08077)" provided in?

    This item is provided in "Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MCM6 Antibody (OAAF08077)"?

    This target may also be called "DNA replication licensing factor MCM6;MCG40308;MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe);minichromosome maintenance deficient (mis5, S. pombe) 6;Mis5;P105MCM." in publications.

  5. What is the shipping cost for "MCM6 Antibody (OAAF08077)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MCM6 Antibody (OAAF08077)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MCM6 Antibody (OAAF08077)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "92 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MCM6 Antibody (OAAF08077)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MCM6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCM6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCM6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCM6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCM6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCM6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MCM6 Antibody (OAAF08077)
Your Rating
We found other products you might like!