- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for MCM3 Antibody (OAAL00189) |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid. PBS, pH 7.4 |
| Clonality | Monoclonal |
| Clone | 2H3 |
| Isotype | IgG2a Kappa |
| Host | Mouse |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Western blot |
| Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
| Immunogen | MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Peptide Sequence | AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Symbol | MCM3 |
|---|---|
| Gene Full Name | minichromosome maintenance complex component 3 |
| Alias Symbols | cervical cancer proto-oncogene 5;DNA polymerase alpha holoenzyme-associated protein P1;DNA replication factor MCM3;DNA replication licensing factor MCM3;HCC5;hRlf beta subunit;MCM3 minichromosome maintenance deficient 3;minichromosome maintenance deficient 3;P1.h;p102;P1-MCM3;replication licensing factor, beta subunit;RLF subunit beta;RLFB. |
| NCBI Gene Id | 4172 |
| Protein Name | DNA replication licensing factor MCM3 isoform 1 [Homo sapiens]|Homo sapiens minichromosome maintenance complex component 3 (MCM3), transcript variant 1, mRNA |
| Description of Target | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq |
| Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_002379 |
| Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_002388 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MCM3 Antibody (OAAL00189)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "MCM3 Antibody (OAAL00189)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "MCM3 Antibody (OAAL00189)" provided in?
This item is provided in "Liquid. PBS, pH 7.4".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MCM3 Antibody (OAAL00189)"?
This target may also be called "cervical cancer proto-oncogene 5;DNA polymerase alpha holoenzyme-associated protein P1;DNA replication factor MCM3;DNA replication licensing factor MCM3;HCC5;hRlf beta subunit;MCM3 minichromosome maintenance deficient 3;minichromosome maintenance deficient 3;P1.h;p102;P1-MCM3;replication licensing factor, beta subunit;RLF subunit beta;RLFB." in publications.
-
What is the shipping cost for "MCM3 Antibody (OAAL00189)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MCM3 Antibody (OAAL00189)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MCM3 Antibody (OAAL00189)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MCM3 Antibody (OAAL00189)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MCM3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MCM3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MCM3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MCM3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MCM3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MCM3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
