MBOAT1 Antibody - N-terminal region (ARP48548_P050)

Catalog No: ARP48548_P050

WB Suggested Anti-MBOAT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: MBOAT1
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: MBOAT1
Sample Tissue: Human U937 Whole Cell
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MBOAT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 100%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 86%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MBOAT1 (ARP48548_P050) antibody is Catalog # AAP48548 (Previous Catalog # AAPY01492)

Target Info

• Reference: Tamaki,H., (2007) J. Biol. Chem. 282 (47), 34288-34298
• Gene Symbol: MBOAT1
• Gene Full Name: Membrane bound O-acyltransferase domain containing 1
• Alias Symbols: LPLAT, LPSAT, OACT1, LPEAT1, LPLAT 1, dJ434O11.1
• NCBI Gene Id: 154141
• Protein Name: Lysophospholipid acyltransferase 1
• Description of Target: MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-304 AL158198.14 79926-80229 c 305-450 AL158198.14 20414-20559 c 451-528 AL158198.14 18975-19052 c 529-624 AL158198.14 12010-12105 c 625-680 AL355139.10 10796-10851 c 681-735 AL355139.10 8351-8405 c 736-919 AL355139.10 6169-6352 c 920-1112 AL355139.10 4060-4252 c 1113-1216 AL008627.1 1909-2012 1217-1281 AL008627.1 5097-5161 1282-1414 AL008627.1 7441-7573 1415-1566 AL008627.1 10700-10851 1567-3275 AL008627.1 18037-19745
• Uniprot ID: Q6ZNC8
• Protein Accession #: NP_001073949
• Nucleotide Accession #: NM_001080480
• Protein Size (# AA): 495
• Molecular Weight: 56kDa