Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41227_P050-FITC Conjugated

ARP41227_P050-HRP Conjugated

ARP41227_P050-Biotin Conjugated

MBNL1 Antibody - middle region (ARP41227_P050)

Catalog#: ARP41227_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-115973 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MBNL1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-MBNL1 (ARP41227_P050)
Peptide Sequence Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MBNL1 (ARP41227_P050) antibody is Catalog # AAP41227 (Previous Catalog # AAPS01306)
Datasheets/Manuals Printable datasheet for anti-MBNL1 (ARP41227_P050) antibody
Sample Type Confirmation

MBNL1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Strausberg,R., (2003) Direct Submission

Coram, RJ; Stillwagon, SJ; Guggilam, A; Jenkins, MW; Swanson, MS; Ladd, AN; Muscleblind-like 1 is required for normal heart valve development in vivo. 15, 36 (2015). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26472242

Gene Symbol MBNL1
Official Gene Full Name Muscleblind-like splicing regulator 1
Alias Symbols EXP, MBNL, EXP35, EXP40, EXP42
NCBI Gene Id 4154
Protein Name MBNL1 protein EMBL AAH50535.1
Description of Target MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
Swissprot Id Q86VM6
Protein Accession # AAH50535
Nucleotide Accession # NM_021038
Protein Size (# AA) 343
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MBNL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MBNL1.
  1. What is the species homology for "MBNL1 Antibody - middle region (ARP41227_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MBNL1 Antibody - middle region (ARP41227_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MBNL1 Antibody - middle region (ARP41227_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MBNL1 Antibody - middle region (ARP41227_P050)"?

    This target may also be called "EXP, MBNL, EXP35, EXP40, EXP42" in publications.

  5. What is the shipping cost for "MBNL1 Antibody - middle region (ARP41227_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MBNL1 Antibody - middle region (ARP41227_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MBNL1 Antibody - middle region (ARP41227_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MBNL1 Antibody - middle region (ARP41227_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MBNL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MBNL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MBNL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MBNL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MBNL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MBNL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MBNL1 Antibody - middle region (ARP41227_P050)
Your Rating
We found other products you might like!