Search Antibody, Protein, and ELISA Kit Solutions

MBNL1 Antibody - middle region (ARP41227_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41227_P050-FITC Conjugated

ARP41227_P050-HRP Conjugated

ARP41227_P050-Biotin Conjugated

Gene Symbol:
MBNL1
Official Gene Full Name:
Muscleblind-like splicing regulator 1
NCBI Gene Id:
4154
Protein Name:
MBNL1 protein EMBL AAH50535.1
Swissprot Id:
Q86VM6
Protein Accession #:
AAH50535
Nucleotide Accession #:
NM_021038
Alias Symbols:
EXP, MBNL, EXP35, EXP40, EXP42
Replacement Item:
This antibody may replace item sc-115973 from Santa Cruz Biotechnology.
Description of Target:
MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.
Protein Size (# AA):
343
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MBNL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MBNL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MBNL1
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MBNL1 (ARP41227_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DAB1; AES; AEN; UBC; ABI3BP; ZNHIT3; VCAM1; ITGA4; IDH3A; FN1; TIAL1; APP; BIN1; ITSN2; DDX17; HNRNPL; HNRNPK; HNRNPH3; HNRNPH2; HNRNPH1; HNRNPF; HNRNPA2B1; DHX9; DDX5;
Blocking Peptide:
For anti-MBNL1 (ARP41227_P050) antibody is Catalog # AAP41227 (Previous Catalog # AAPS01306)
Datasheets/Manuals:
Printable datasheet for anti-MBNL1 (ARP41227_P050) antibody
Sample Type Confirmation:

MBNL1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Strausberg,R., (2003) Direct Submission
Publications:

Coram, RJ; Stillwagon, SJ; Guggilam, A; Jenkins, MW; Swanson, MS; Ladd, AN; Muscleblind-like 1 is required for normal heart valve development in vivo. 15, 36 (2015). IHC, WB, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 26472242

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...