Search Antibody, Protein, and ELISA Kit Solutions

MBL2 Antibody - middle region (ARP45676_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45676_P050-FITC Conjugated

ARP45676_P050-HRP Conjugated

ARP45676_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Mannose-binding lectin (protein C) 2, soluble
NCBI Gene Id:
Protein Name:
Mannose-binding protein C
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-17908 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MBL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MBL2.
The immunogen is a synthetic peptide directed towards the middle region of human MBL2
Predicted Species Reactivity:
Cow, Goat, Horse, Human, Pig, Rat, Sheep
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Goat: 77%; Horse: 92%; Human: 100%; Pig: 92%; Rat: 77%; Sheep: 77%
Complete computational species homology data:
Anti-MBL2 (ARP45676_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MBL2 (ARP45676_P050) antibody is Catalog # AAP45676 (Previous Catalog # AAPP26688)
Printable datasheet for anti-MBL2 (ARP45676_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...