Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

Mbd3 Antibody - N-terminal region (ARP40171_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40171_P050-FITC Conjugated

ARP40171_P050-HRP Conjugated

ARP40171_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Methyl-CpG binding domain protein 3
NCBI Gene Id:
Protein Name:
Methyl-CpG-binding domain protein 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AI181826, AU019209
Replacement Item:
This antibody may replace item sc-115968 from Santa Cruz Biotechnology.
Description of Target:
The function of Mbd3 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Mbd3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Mbd3.
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Dog, Guinea Pig, Human, Mouse, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Complete computational species homology data:
Anti-Mbd3 (ARP40171_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Nanog; Plcb1; L3mbtl2; Pou5f1; Runx1; Mta2; Gata1; SMARCA4; DNMT3A; Mta1; Sall4; Tfcp2l1; Esrrb; Hdac2;
Blocking Peptide:
For anti-Mbd3 (ARP40171_P050) antibody is Catalog # AAP40171 (Previous Catalog # AAPP20914)
Printable datasheet for anti-Mbd3 (ARP40171_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...