Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP32012_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32012_P050-FITC Conjugated

ARP32012_P050-HRP Conjugated

ARP32012_P050-Biotin Conjugated

MBD1 Antibody - C-terminal region (ARP32012_P050)

Catalog#: ARP32012_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10751 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MBD1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-MBD1 (ARP32012_P050)
Peptide Sequence Synthetic peptide located within the following region: NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MBD1 (ARP32012_P050) antibody is Catalog # AAP32012 (Previous Catalog # AAPP23942)
Datasheets/Manuals Printable datasheet for anti-MBD1 (ARP32012_P050) antibody
Target Reference Villa,R., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1400-1405
Publications

Jungwirth, M., Dear, M. L., Brown, P., Holbrook, K. & Goodchild, R. Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA. Hum. Mol. Genet. 19, 888-900 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20034025

Gene Symbol MBD1
Official Gene Full Name Methyl-CpG binding domain protein 1
Alias Symbols CXXC3, PCM1, RFT
NCBI Gene Id 4152
Protein Name Methyl-CpG-binding domain protein 1
Description of Target MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.
Swissprot Id Q9UIS9-3
Protein Accession # NP_056669
Nucleotide Accession # NM_015844
Protein Size (# AA) 549
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MBD1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MBD1.
Protein Interactions SUMO1; HTT; UBC; ECT2; APP; ATXN1L; TENM1; SUMO2; HIST1H3A; PCNA; ATF7IP2; ATF7IP; CHAF1A; SETDB1; PIAS1; STAT1; PRAM1; HDAC3; PIAS2; ZNF512B; Rnf2; CBX4; CBX5; HIPK3; SMAD9; OASL; SMAD5; SMAD3; SMAD7; SMAD1; SUV39H1;
  1. What is the species homology for "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MBD1 Antibody - C-terminal region (ARP32012_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    This target may also be called "CXXC3, PCM1, RFT" in publications.

  5. What is the shipping cost for "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MBD1 Antibody - C-terminal region (ARP32012_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MBD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MBD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MBD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MBD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MBD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MBD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MBD1 Antibody - C-terminal region (ARP32012_P050)
Your Rating
We found other products you might like!