Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

MBD1 Antibody - C-terminal region (ARP32012_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32012_P050-FITC Conjugated

ARP32012_P050-HRP Conjugated

ARP32012_P050-Biotin Conjugated

Gene Symbol:
MBD1
Official Gene Full Name:
Methyl-CpG binding domain protein 1
NCBI Gene Id:
4152
Protein Name:
Methyl-CpG-binding domain protein 1
Swissprot Id:
Q9UIS9-3
Protein Accession #:
NP_056669
Nucleotide Accession #:
NM_015844
Alias Symbols:
CXXC3, PCM1, RFT
Replacement Item:
This antibody may replace item sc-10751 from Santa Cruz Biotechnology.
Description of Target:
MBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.
Protein Size (# AA):
549
Molecular Weight:
60kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MBD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MBD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MBD1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MBD1 (ARP32012_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO1; HTT; UBC; ECT2; APP; ATXN1L; TENM1; SUMO2; HIST1H3A; PCNA; ATF7IP2; ATF7IP; CHAF1A; SETDB1; PIAS1; STAT1; PRAM1; HDAC3; PIAS2; ZNF512B; Rnf2; CBX4; CBX5; HIPK3; SMAD9; OASL; SMAD5; SMAD3; SMAD7; SMAD1; SUV39H1;
Blocking Peptide:
For anti-MBD1 (ARP32012_P050) antibody is Catalog # AAP32012 (Previous Catalog # AAPP23942)
Datasheets/Manuals:
Printable datasheet for anti-MBD1 (ARP32012_P050) antibody
Target Reference:
Villa,R., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1400-1405
Publications:

Jungwirth, M., Dear, M. L., Brown, P., Holbrook, K. & Goodchild, R. Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA. Hum. Mol. Genet. 19, 888-900 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20034025

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...