Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP32012_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32012_P050-FITC Conjugated

ARP32012_P050-HRP Conjugated

ARP32012_P050-Biotin Conjugated

MBD1 Antibody - C-terminal region (ARP32012_P050)

Catalog#: ARP32012_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-10751 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MBD1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-MBD1 (ARP32012_P050)
Peptide SequenceSynthetic peptide located within the following region: NKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSKDLKKP
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MBD1 (ARP32012_P050) antibody is Catalog # AAP32012 (Previous Catalog # AAPP23942)
Datasheets/ManualsPrintable datasheet for anti-MBD1 (ARP32012_P050) antibody
Target ReferenceVilla,R., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (5), 1400-1405
Publications

Jungwirth, M., Dear, M. L., Brown, P., Holbrook, K. & Goodchild, R. Relative tissue expression of homologous torsinB correlates with the neuronal specific importance of DYT1 dystonia-associated torsinA. Hum. Mol. Genet. 19, 888-900 (2010). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20034025

Gene SymbolMBD1
Official Gene Full NameMethyl-CpG binding domain protein 1
Alias SymbolsCXXC3, PCM1, RFT
NCBI Gene Id4152
Protein NameMethyl-CpG-binding domain protein 1
Description of TargetMBD1 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD1 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.
Swissprot IdQ9UIS9-3
Protein Accession #NP_056669
Nucleotide Accession #NM_015844
Protein Size (# AA)549
Molecular Weight60kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MBD1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MBD1.
Protein InteractionsSUMO1; HTT; UBC; ECT2; APP; ATXN1L; TENM1; SUMO2; HIST1H3A; PCNA; ATF7IP2; ATF7IP; CHAF1A; SETDB1; PIAS1; STAT1; PRAM1; HDAC3; PIAS2; ZNF512B; Rnf2; CBX4; CBX5; HIPK3; SMAD9; OASL; SMAD5; SMAD3; SMAD7; SMAD1; SUV39H1;
Write Your Own Review
You're reviewing:MBD1 Antibody - C-terminal region (ARP32012_P050)
Your Rating
Aviva Validation Data
Aviva HIS tag Deal
Aviva Tips and Tricks
Free Microscope