Size:100 ul
$319.00
In Stock
SKU
ARP38146_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38146_P050-FITC Conjugated

ARP38146_P050-HRP Conjugated

ARP38146_P050-Biotin Conjugated

MAZ Antibody - N-terminal region (ARP38146_P050)

Catalog#: ARP38146_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Human, Mouse, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130915 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data Anti-MAZ (ARP38146_P050)
Peptide Sequence Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MAZ (ARP38146_P050) antibody is Catalog # AAP38146 (Previous Catalog # AAPP10733)
Datasheets/Manuals Printable datasheet for anti-MAZ (ARP38146_P050) antibody
Sample Type Confirmation

MAZ is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Ray,B.K., (2007) J. Immunol. 178 (3), 1774-1782
Publications

Smits, M. et al. Myc-associated zinc finger protein (MAZ) is regulated by miR-125b and mediates VEGF-induced angiogenesis in glioblastoma. FASEB J. 26, 2639-47 (2012). IHC, WB, Human, Mouse, Pig, Rat 22415301

Gene Symbol MAZ
Official Gene Full Name MYC-associated zinc finger protein (purine-binding transcription factor)
Alias Symbols PUR1, Pur-1, SAF-1, SAF-2, ZF87, ZNF801, Zif87, SAF-3
NCBI Gene Id 4150
Protein Name Myc-associated zinc finger protein
Description of Target MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
Swissprot Id P56270
Protein Accession # NP_002374
Nucleotide Accession # NM_002383
Protein Size (# AA) 477
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MAZ.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MAZ.
Protein Interactions HECW2; MAPK14; BPTF; JUN; FOS; KEAP1; DCC; CSNK2A1;
  1. What is the species homology for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Pig, Rat".

  2. How long will it take to receive "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAZ Antibody - N-terminal region (ARP38146_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    This target may also be called "PUR1, Pur-1, SAF-1, SAF-2, ZF87, ZNF801, Zif87, SAF-3" in publications.

  5. What is the shipping cost for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAZ Antibody - N-terminal region (ARP38146_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MAZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAZ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAZ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAZ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAZ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAZ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAZ Antibody - N-terminal region (ARP38146_P050)
Your Rating
We found other products you might like!