Search Antibody, Protein, and ELISA Kit Solutions

MAZ Antibody - N-terminal region (ARP38146_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38146_P050-FITC Conjugated

ARP38146_P050-HRP Conjugated

ARP38146_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
MYC-associated zinc finger protein (purine-binding transcription factor)
NCBI Gene Id:
Protein Name:
Myc-associated zinc finger protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
PUR1, Pur-1, SAF-1, SAF-2, ZF87, ZNF801, Zif87, SAF-3
Replacement Item:
This antibody may replace item sc-130915 from Santa Cruz Biotechnology.
Description of Target:
MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAZ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAZ.
The immunogen is a synthetic peptide directed towards the N terminal region of human MAZ
Predicted Species Reactivity:
Human, Mouse, Pig, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-MAZ (ARP38146_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MAZ (ARP38146_P050) antibody is Catalog # AAP38146 (Previous Catalog # AAPP10733)
Printable datasheet for anti-MAZ (ARP38146_P050) antibody
Sample Type Confirmation:

MAZ is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Ray,B.K., (2007) J. Immunol. 178 (3), 1774-1782

Smits, M. et al. Myc-associated zinc finger protein (MAZ) is regulated by miR-125b and mediates VEGF-induced angiogenesis in glioblastoma. FASEB J. 26, 2639-47 (2012). IHC, WB, Human, Mouse, Pig, Rat 22415301

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...