Size:100 ul
$249.00
In Stock
SKU
ARP40922_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40922_T100-FITC Conjugated

ARP40922_T100-HRP Conjugated

ARP40922_T100-Biotin Conjugated

MATR3 Antibody - N-terminal region (ARP40922_T100)

Catalog#: ARP40922_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-176323 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MATR3
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data Anti-MATR3 (ARP40922_T100)
Peptide Sequence Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MATR3 (ARP40922_T100) antibody is Catalog # AAP40922 (Previous Catalog # AAPP22890)
Datasheets/Manuals Printable datasheet for anti-MATR3 (ARP40922_T100) antibody
Sample Type Confirmation

MATR3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Publications

Kula, A. et al. Characterization of the HIV-1 RNA associated proteome identifies Matrin 3 as a nuclear cofactor of Rev function. Retrovirology 8, 60 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21771346

Kula, A., Gharu, L. & Marcello, A. HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3. Virology 435, 329-40 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23158102

Valencia, C. A., Ju, W. & Liu, R. Matrin 3 is a Ca2+/calmodulin-binding protein cleaved by caspases. Biochem. Biophys. Res. Commun. 361, 281-6 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 17658460

Gene Symbol MATR3
Official Gene Full Name Matrin 3
Alias Symbols MPD2, VCPDM
NCBI Gene Id 9782
Protein Name Matrin-3
Description of Target MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.
Swissprot Id P43243
Protein Accession # NP_061322
Nucleotide Accession # NM_018834
Protein Size (# AA) 847
Molecular Weight 93kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MATR3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MATR3.
Protein Interactions RASD1; MATR3; UBC; HNRNPK; CEP250; AURKA; SUMO2; SUMO3; STAU1; LGR4; SUMO1; MDM2; RPA3; RPA2; RPA1; ERG; WWOX; EED; rev; PARK2; TARDBP; PAN2; ITGA4; IFIT2; FN1; MAP1LC3A; PTBP2; vpr; MAGOH; EIF4A3; PRKCDBP; NAA15; IARS2; SMU1; SARS2; STOML2; RRP7A; MYOF;
  1. What is the species homology for "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MATR3 Antibody - N-terminal region (ARP40922_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    This target may also be called "MPD2, VCPDM" in publications.

  5. What is the shipping cost for "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "93kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MATR3 Antibody - N-terminal region (ARP40922_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MATR3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MATR3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MATR3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MATR3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MATR3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MATR3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MATR3 Antibody - N-terminal region (ARP40922_T100)
Your Rating
We found other products you might like!