Search Antibody, Protein, and ELISA Kit Solutions

MATR3 Antibody - N-terminal region (ARP40922_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40922_T100-FITC Conjugated

ARP40922_T100-HRP Conjugated

ARP40922_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MATR3
Official Gene Full Name:
Matrin 3
NCBI Gene Id:
9782
Protein Name:
Matrin-3
Swissprot Id:
P43243
Protein Accession #:
NP_061322
Nucleotide Accession #:
NM_018834
Alias Symbols:
MPD2, VCPDM
Replacement Item:
This antibody may replace item sc-176323 from Santa Cruz Biotechnology.
Description of Target:
MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.
Protein Size (# AA):
847
Molecular Weight:
93kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MATR3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MATR3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MATR3
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-MATR3 (ARP40922_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RASD1; MATR3; UBC; HNRNPK; CEP250; AURKA; SUMO2; SUMO3; STAU1; LGR4; SUMO1; MDM2; RPA3; RPA2; RPA1; ERG; WWOX; EED; rev; PARK2; TARDBP; PAN2; ITGA4; IFIT2; FN1; MAP1LC3A; PTBP2; vpr; MAGOH; EIF4A3; PRKCDBP; NAA15; IARS2; SMU1; SARS2; STOML2; RRP7A; MYOF;
Blocking Peptide:
For anti-MATR3 (ARP40922_T100) antibody is Catalog # AAP40922 (Previous Catalog # AAPP22890)
Datasheets/Manuals:
Printable datasheet for anti-MATR3 (ARP40922_T100) antibody
Sample Type Confirmation:

MATR3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Publications:

Kula, A. et al. Characterization of the HIV-1 RNA associated proteome identifies Matrin 3 as a nuclear cofactor of Rev function. Retrovirology 8, 60 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21771346

Kula, A., Gharu, L. & Marcello, A. HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3. Virology 435, 329-40 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23158102

Valencia, C. A., Ju, W. & Liu, R. Matrin 3 is a Ca2+/calmodulin-binding protein cleaved by caspases. Biochem. Biophys. Res. Commun. 361, 281-6 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 17658460

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...