Size:100 ul
$249.00
In stock
SKU
ARP40922_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40922_T100-FITC Conjugated

ARP40922_T100-HRP Conjugated

ARP40922_T100-Biotin Conjugated

MATR3 Antibody - N-terminal region (ARP40922_T100)

Catalog#: ARP40922_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-176323 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MATR3
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-MATR3 (ARP40922_T100)
Peptide SequenceSynthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MATR3 (ARP40922_T100) antibody is Catalog # AAP40922 (Previous Catalog # AAPP22890)
Datasheets/ManualsPrintable datasheet for anti-MATR3 (ARP40922_T100) antibody
Sample Type Confirmation

MATR3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceBeausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135
Publications

Kula, A. et al. Characterization of the HIV-1 RNA associated proteome identifies Matrin 3 as a nuclear cofactor of Rev function. Retrovirology 8, 60 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 21771346

Kula, A., Gharu, L. & Marcello, A. HIV-1 pre-mRNA commitment to Rev mediated export through PSF and Matrin 3. Virology 435, 329-40 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23158102

Valencia, C. A., Ju, W. & Liu, R. Matrin 3 is a Ca2+/calmodulin-binding protein cleaved by caspases. Biochem. Biophys. Res. Commun. 361, 281-6 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 17658460

Gene SymbolMATR3
Official Gene Full NameMatrin 3
Alias SymbolsMPD2, VCPDM
NCBI Gene Id9782
Protein NameMatrin-3
Description of TargetMATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.
Swissprot IdP43243
Protein Accession #NP_061322
Nucleotide Accession #NM_018834
Protein Size (# AA)847
Molecular Weight93kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MATR3.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MATR3.
Protein InteractionsRASD1; MATR3; UBC; HNRNPK; CEP250; AURKA; SUMO2; SUMO3; STAU1; LGR4; SUMO1; MDM2; RPA3; RPA2; RPA1; ERG; WWOX; EED; rev; PARK2; TARDBP; PAN2; ITGA4; IFIT2; FN1; MAP1LC3A; PTBP2; vpr; MAGOH; EIF4A3; PRKCDBP; NAA15; IARS2; SMU1; SARS2; STOML2; RRP7A; MYOF;
Write Your Own Review
You're reviewing:MATR3 Antibody - N-terminal region (ARP40922_T100)
Your Rating
Aviva Blast Tool
Aviva Live Chat
Aviva Pathways
Aviva ChIP Antibodies