- Gene Symbol:
- MATN2
- NCBI Gene Id:
- 4147
- Official Gene Full Name:
- Matrilin 2
- Protein Name:
- Matrilin-2
- Swissprot Id:
- A8K106
- Protein Accession #:
- NP_085072
- Nucleotide Accession #:
- NM_030583
- Alias Symbols:
- -
- Description of Target:
- MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
- Protein Size (# AA):
- 937
- Molecular Weight:
- 102kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express MATN2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express MATN2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human MATN2
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%
- Complete computational species homology data:
- Anti-MATN2 (ARP57667_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- DVL3; CBFA2T3; ATXN1L; ATXN1; ATXN7; CACNA1A; MATN4; MATN2; COL4A6; COL4A5; FN1; FBN2; COL1A1; COL4A4; COL4A1; COL4A2; COL4A3; MATN1; MATN3;
- Blocking Peptide:
- For anti-MATN2 (ARP57667_P050) antibody is Catalog # AAP57667 (Previous Catalog # AAPP35443)
- Datasheets/Manuals:
- Printable datasheet for anti-MATN2 (ARP57667_P050) antibody
- Target Reference:
- Ichikawa,T., (2008) Biochem. Biophys. Res. Commun. 369 (4), 994-1000
- Publications:
Szalai, E. et al. Fibrillin-2, tenascin-C, matrilin-2, and matrilin-4 are strongly expressed in the epithelium of human granular and lattice type I corneal dystrophies. Mol. Vis. 18, 1927-36 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22876117
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
