Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP57667_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57667_P050-FITC Conjugated

ARP57667_P050-HRP Conjugated

ARP57667_P050-Biotin Conjugated

MATN2 Antibody - middle region (ARP57667_P050)

Catalog#: ARP57667_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MATN2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%
Complete computational species homology data Anti-MATN2 (ARP57667_P050)
Peptide Sequence Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MATN2 (ARP57667_P050) antibody is Catalog # AAP57667 (Previous Catalog # AAPP35443)
Datasheets/Manuals Printable datasheet for anti-MATN2 (ARP57667_P050) antibody
Target Reference Ichikawa,T., (2008) Biochem. Biophys. Res. Commun. 369 (4), 994-1000
Publications

Szalai, E. et al. Fibrillin-2, tenascin-C, matrilin-2, and matrilin-4 are strongly expressed in the epithelium of human granular and lattice type I corneal dystrophies. Mol. Vis. 18, 1927-36 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22876117

Gene Symbol MATN2
Official Gene Full Name Matrilin 2
Alias Symbols -
NCBI Gene Id 4147
Protein Name Matrilin-2
Description of Target MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id A8K106
Protein Accession # NP_085072
Nucleotide Accession # NM_030583
Protein Size (# AA) 937
Molecular Weight 102kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MATN2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MATN2.
Protein Interactions DVL3; CBFA2T3; ATXN1L; ATXN1; ATXN7; CACNA1A; MATN4; MATN2; COL4A6; COL4A5; FN1; FBN2; COL1A1; COL4A4; COL4A1; COL4A2; COL4A3; MATN1; MATN3;
Write Your Own Review
You're reviewing:MATN2 Antibody - middle region (ARP57667_P050)
Your Rating