Loading...
Catalog No: ARP57667_P050
Price: $0.00
SKU
ARP57667_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MATN2 (ARP57667_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MATN2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%
Peptide SequenceSynthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED
Concentration0.5 mg/ml
Blocking PeptideFor anti-MATN2 (ARP57667_P050) antibody is Catalog # AAP57667 (Previous Catalog # AAPP35443)
ReferenceIchikawa,T., (2008) Biochem. Biophys. Res. Commun. 369 (4), 994-1000
Publications

Extracellular matrix changes in corneal opacification vary depending on etiology. Mol Vis. 27, 26-36 (2021). 33633437

Szalai, E. et al. Fibrillin-2, tenascin-C, matrilin-2, and matrilin-4 are strongly expressed in the epithelium of human granular and lattice type I corneal dystrophies. Mol. Vis. 18, 1927-36 (2012). 22876117

Description
Gene SymbolMATN2
Gene Full NameMatrilin 2
Alias Symbols-
NCBI Gene Id4147
Protein NameMatrilin-2
Description of TargetMATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDA8K106
Protein Accession #NP_085072
Nucleotide Accession #NM_030583
Protein Size (# AA)937
Molecular Weight107 kDa
Protein InteractionsDVL3; CBFA2T3; ATXN1L; ATXN1; ATXN7; CACNA1A; MATN4; MATN2; COL4A6; COL4A5; FN1; FBN2; COL1A1; COL4A4; COL4A1; COL4A2; COL4A3; MATN1; MATN3;
  1. What is the species homology for "MATN2 Antibody - middle region (ARP57667_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MATN2 Antibody - middle region (ARP57667_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MATN2 Antibody - middle region (ARP57667_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MATN2 Antibody - middle region (ARP57667_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "MATN2 Antibody - middle region (ARP57667_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MATN2 Antibody - middle region (ARP57667_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MATN2 Antibody - middle region (ARP57667_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "107 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MATN2 Antibody - middle region (ARP57667_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MATN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MATN2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MATN2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MATN2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MATN2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MATN2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MATN2 Antibody - middle region (ARP57667_P050)
Your Rating