Search Antibody, Protein, and ELISA Kit Solutions

MAT1A Antibody - C-terminal region (ARP41399_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41399_T100-FITC Conjugated

ARP41399_T100-HRP Conjugated

ARP41399_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MAT1A
Official Gene Full Name:
Methionine adenosyltransferase I, alpha
NCBI Gene Id:
4143
Protein Name:
S-adenosylmethionine synthase isoform type-1
Swissprot Id:
Q00266
Protein Accession #:
NP_000420
Nucleotide Accession #:
NM_000429
Alias Symbols:
MAT, MATA1, SAMS, SAMS1
Replacement Item:
This antibody may replace item sc-106202 from Santa Cruz Biotechnology.
Description of Target:
MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.
Protein Size (# AA):
395
Molecular Weight:
44kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAT1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAT1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MAT1A
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-MAT1A (ARP41399_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAT1A; UBC; IST1; MVK; MAT2A;
Blocking Peptide:
For anti-MAT1A (ARP41399_T100) antibody is Catalog # AAP41399 (Previous Catalog # AAPP24137)
Datasheets/Manuals:
Printable datasheet for anti-MAT1A (ARP41399_T100) antibody
Target Reference:
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...