MASP2 Antibody - N-terminal region (ARP41573_P050)

Size:100 ul

Human OVCAR3

Human Adult Liver

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-17905 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MASP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 77%
• Complete computational species homology data: Anti-MASP2 (ARP41573_P050)
• Peptide Sequence: Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MASP2 (ARP41573_P050) antibody is Catalog # AAP41573 (Previous Catalog # AAPP24258)
• Datasheets/Manuals: Printable datasheet for anti-MASP2 (ARP41573_P050) antibody
• Sample Type Confirmation:

  MASP2 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• Target Reference: Segat,L., (2008) J. Viral Hepat. 15 (5), 387-391

Target Info

• Gene Symbol: MASP2
• Official Gene Full Name: Mannan-binding lectin serine peptidase 2
• Alias Symbols: MAP19, MASP-2, sMAP, MASP1P1
• NCBI Gene Id: 10747
• Protein Name: Mannan-binding lectin serine protease 2
• Description of Target: The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components th
• Swissprot Id: O00187
• Protein Accession #: NP_006601
• Nucleotide Accession #: NM_006610
• Protein Size (# AA): 686
• Molecular Weight: 27kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express MASP2.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MASP2.
• Protein Interactions: Dlg4; SERPING1; MASP2; FCN2; MBL2; MASP1;