Search Antibody, Protein, and ELISA Kit Solutions

MASP2 antibody - N-terminal region (ARP41573_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41573_P050-FITC Conjugated

ARP41573_P050-HRP Conjugated

ARP41573_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mannan-binding lectin serine peptidase 2
Protein Name:
Mannan-binding lectin serine protease 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-17905 from Santa Cruz Biotechnology.
Description of Target:
The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components th
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MASP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MASP2.
The immunogen is a synthetic peptide directed towards the N terminal region of human MASP2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-MASP2 (ARP41573_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MASP2 (ARP41573_P050) antibody is Catalog # AAP41573 (Previous Catalog # AAPP24258)
Printable datasheet for anti-MASP2 (ARP41573_P050) antibody
Sample Type Confirmation:

MASP2 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

Target Reference:
Segat,L., (2008) J. Viral Hepat. 15 (5), 387-391

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...