- Gene Symbol:
- MASP2
- NCBI Gene Id:
- 10747
- Official Gene Full Name:
- Mannan-binding lectin serine peptidase 2
- Protein Name:
- Mannan-binding lectin serine protease 2
- Swissprot Id:
- O00187
- Protein Accession #:
- NP_006601
- Nucleotide Accession #:
- NM_006610
- Alias Symbols:
- MAP19, MASP-2, sMAP, MASP1P1
- Replacement Item:
- This antibody may replace item sc-17905 from Santa Cruz Biotechnology.
- Description of Target:
- The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components th
- Protein Size (# AA):
- 686
- Molecular Weight:
- 27kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express MASP2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express MASP2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human MASP2
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 77%
- Complete computational species homology data:
- Anti-MASP2 (ARP41573_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- Dlg4; SERPING1; MASP2; FCN2; MBL2; MASP1;
- Blocking Peptide:
- For anti-MASP2 (ARP41573_P050) antibody is Catalog # AAP41573 (Previous Catalog # AAPP24258)
- Datasheets/Manuals:
- Printable datasheet for anti-MASP2 (ARP41573_P050) antibody
- Sample Type Confirmation:
MASP2 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3
- Target Reference:
- Segat,L., (2008) J. Viral Hepat. 15 (5), 387-391
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
