MASP1 Antibody - N-terminal region (ARP63877_P050)

Catalog No: ARP63877_P050

WB Suggested Anti-MASP1 Antibody
Titration: 1.0 ug/ml
Positive Control: HT1080 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MASP1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MASP1 (ARP63877_P050) antibody is Catalog # AAP63877

Target Info

• Gene Symbol: MASP1
• Alias Symbols: 3MC1, MAP1, MASP, RaRF, CRARF, MASP3, MAp44, PRSS5, CRARF1
• NCBI Gene Id: 5648
• Protein Name: Mannan-binding lectin serine protease 1
• Description of Target: This gene encodes a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The encoded protein is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. The encoded protein is also able to cleave fibrinogen and factor XIII and may may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway.
• Uniprot ID: P48740
• Protein Accession #: NP_001870
• Nucleotide Accession #: NM_001879
• Protein Size (# AA): 699
• Molecular Weight: 28kDa
• Protein Interactions: CDK19; CUL3; PDCD6IP; RPS6KA6; MAPK8IP2; NUDT21; NCK2; UFD1L; RPS6KA3; MAPK6; H2AFX; GSK3B; GADD45A; C2; SERPING1; FCN2; MBL2; C3; MASP2;