Search Antibody, Protein, and ELISA Kit Solutions

MARCH8 Antibody - N-terminal region : FITC (ARP75860_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75860_P050 Unconjugated

ARP75860_P050-HRP Conjugated

ARP75860_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MARCH8
Official Gene Full Name:
membrane associated ring-CH-type finger 8
NCBI Gene Id:
220972
Protein Name:
E3 ubiquitin-protein ligase MARCH8
Swissprot Id:
Q5T0T0
Alias Symbols:
MIR, CMIR, c-MIR, RNF178, MARCH-VIII
Description of Target:
MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010]
Protein Size (# AA):
291
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MARCH8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MARCH8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MARH8
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
TNFRSF10A; UBC; UBE2H; UBE2D1; TFRC; UBE2D3; IL1RAP; IL1R1; CD86;
Blocking Peptide:
For anti-MARCH8 (ARP75860_P050-FITC) antibody is Catalog # AAP75860
Datasheets/Manuals:
Printable datasheet for anti-MARCH8 (ARP75860_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...