Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP85040_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MAPK9 Antibody - C-terminal region (ARP85040_P050)

Catalog#: ARP85040_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK9
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: QIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MAPK9 (ARP85040_P050) antibody is Catalog # AAP85040
Datasheets/Manuals Printable datasheet for anti-MAPK9 (ARP85040_P050) antibody
Gene Symbol MAPK9
Official Gene Full Name mitogen-activated protein kinase 9
Alias Symbols JNK2, SAPK, p54a, JNK2A, JNK2B, PRKM9, JNK-55, SAPK1a, JNK2BETA, p54aSAPK, JNK2ALPHA
NCBI Gene Id 5601
Protein Name mitogen-activated protein kinase 9
Description of Target The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Swissprot Id P45984-2
Protein Accession # NP_001128516.1
Nucleotide Accession # NM_001135044.1
Protein Size (# AA) 382
Molecular Weight 42 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MAPK9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MAPK9.
  1. What is the species homology for "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "MAPK9 Antibody - C-terminal region (ARP85040_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    This target may also be called "JNK2, SAPK, p54a, JNK2A, JNK2B, PRKM9, JNK-55, SAPK1a, JNK2BETA, p54aSAPK, JNK2ALPHA" in publications.

  5. What is the shipping cost for "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "42 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAPK9 Antibody - C-terminal region (ARP85040_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MAPK9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAPK9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAPK9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAPK9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAPK9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAPK9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAPK9 Antibody - C-terminal region (ARP85040_P050)
Your Rating
We found other products you might like!