Search Antibody, Protein, and ELISA Kit Solutions

MAPK9 Antibody - C-terminal region (ARP85040_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MAPK9
Official Gene Full Name:
mitogen-activated protein kinase 9
NCBI Gene Id:
5601
Protein Name:
mitogen-activated protein kinase 9
Swissprot Id:
P45984-2
Protein Accession #:
NP_001128516.1
Nucleotide Accession #:
NM_001135044.1
Alias Symbols:
JNK2, SAPK, p54a, JNK2A, JNK2B, PRKM9, JNK-55, SAPK1a, JNK2BETA, p54aSAPK, JNK2ALPHA
Description of Target:
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. This gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Protein Size (# AA):
382
Molecular Weight:
42 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAPK9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAPK9.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK9
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MAPK9 (ARP85040_P050) antibody is Catalog # AAP85040
Datasheets/Manuals:
Printable datasheet for anti-MAPK9 (ARP85040_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...