Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP88743_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MAPK7 Antibody - N-terminal region (ARP88743_P050)

Catalog#: ARP88743_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MAPK7
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MAPK7 (ARP88743_P050) antibody is Catalog # AAP88743
Datasheets/ManualsPrintable datasheet for anti-MAPK7 (ARP88743_P050) antibody
Gene SymbolMAPK7
Official Gene Full Namemitogen-activated protein kinase 7
Alias SymbolsBMK1, ERK4, ERK5, PRKM7
NCBI Gene Id5598
Protein Namemitogen-activated protein kinase 7
Description of TargetThe protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Swissprot IdQ13164-3
Protein Accession #NP_002740.2
Nucleotide Accession #NM_002749.3
Protein Size (# AA)533
Molecular Weight58 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MAPK7.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MAPK7.
Write Your Own Review
You're reviewing:MAPK7 Antibody - N-terminal region (ARP88743_P050)
Your Rating
Free Microscope
Aviva Validation Data
Aviva Travel Grant
Aviva Pathways