Search Antibody, Protein, and ELISA Kit Solutions

MAPK7 Antibody - middle region (ARP57731_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP57731_P050-FITC Conjugated

ARP57731_P050-HRP Conjugated

ARP57731_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-1284 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MAPK7
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MAPK7 (ARP57731_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MAPK7 (ARP57731_P050) antibody is Catalog # AAP57731 (Previous Catalog # AAPP44083)
Datasheets/Manuals:
Printable datasheet for anti-MAPK7 (ARP57731_P050) antibody
Gene Symbol:
MAPK7
Official Gene Full Name:
Mitogen-activated protein kinase 7
Alias Symbols:
BMK1, ERK4, ERK5, PRKM7
NCBI Gene Id:
5598
Protein Name:
Mitogen-activated protein kinase 7
Description of Target:
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Swissprot Id:
Q13164
Protein Accession #:
NP_620603
Nucleotide Accession #:
NM_139034
Protein Size (# AA):
816
Molecular Weight:
88kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAPK7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAPK7.
Protein Interactions:
PRKCZ; NFE2L2; UBE2C; MAP3K2; TP53; MAP2K5; PML; DSG1; DSC1; PFDN6; VBP1; MAPK7; PFDN5; PFDN4; PFDN2; PFDN1; JUP; GAPDH; BAG3; PKM; LDHC; HSP90AB1; HSPA5; HSPA4; ATP5A1; ACTB; PPP3CA; TUBB; MYLK2; GANAB; CDC37; YWHAZ; YWHAH; YWHAG; YWHAE; UBC; HSP90B1; FS

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...