Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MAPK7 antibody - middle region (ARP57731_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP57731_P050-FITC Conjugated

ARP57731_P050-HRP Conjugated

ARP57731_P050-Biotin Conjugated

Gene Symbol:
MAPK7
NCBI Gene Id:
5598
Official Gene Full Name:
Mitogen-activated protein kinase 7
Protein Name:
Mitogen-activated protein kinase 7
Swissprot Id:
Q13164
Protein Accession #:
NP_620603
Nucleotide Accession #:
NM_139034
Alias Symbols:
BMK1, ERK4, ERK5, PRKM7
Replacement Item:
This antibody may replace item sc-1284 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Protein Size (# AA):
816
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAPK7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAPK7.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MAPK7
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MAPK7 (ARP57731_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PRKCZ; NFE2L2; UBE2C; MAP3K2; TP53; MAP2K5; PML; DSG1; DSC1; PFDN6; VBP1; MAPK7; PFDN5; PFDN4; PFDN2; PFDN1; JUP; GAPDH; BAG3; PKM; LDHC; HSP90AB1; HSPA5; HSPA4; ATP5A1; ACTB; PPP3CA; TUBB; MYLK2; GANAB; CDC37; YWHAZ; YWHAH; YWHAG; YWHAE; UBC; HSP90B1; FS
Blocking Peptide:
For anti-MAPK7 (ARP57731_P050) antibody is Catalog # AAP57731 (Previous Catalog # AAPP44083)
Datasheets/Manuals:
Printable datasheet for anti-MAPK7 (ARP57731_P050) antibody

Tell us what you think about this item!

Write A Review
    Please, wait...