Catalog No: AVARP06004_T100
Price: $0.00
SKU
AVARP06004_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MAPK14 (AVARP06004_T100) antibody
Product Info
ReferenceChoi,S.Y., et al., (2006) J. Biol. Chem. 281 (11), 7049-7059
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MAPK14
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: YHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Concentration1.0 mg/ml
Blocking PeptideFor anti-MAPK14 (AVARP06004_T100) antibody is Catalog # AAP30459
Sample Type Confirmation

MAPK14 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Gene SymbolMAPK14
Gene Full NameMitogen-activated protein kinase 14
Alias SymbolsRK, p38, CSBP, EXIP, Mxi2, CSBP1, CSBP2, CSPB1, PRKM14, PRKM15, SAPK2A, p38ALPHA
NCBI Gene Id1432
Protein NameMitogen-activated protein kinase 14
Description of TargetMAPK14 is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Uniprot IDQ16539
Protein Accession #NP_001306
Nucleotide Accession #NM_001315
Protein Size (# AA)360
Molecular Weight41kDa
Protein InteractionsMAPKAPK2; ATF2; PDX1; UBC; MARCKSL1; MAP2K3; MAPK14; ATF6; TCEAL1; USP11; PTPN11; OXCT1; NME1; WDR1; HSPD1; TYMS; ADSS; IQGAP1; MKNK1; MAPKAPK3; CNBP; AKT1; CCDC8; OBSL1; RRP1B; RPS6KA4; SRPK1; MAP2K6; MAPK11; NEB; MAZ; MKNK2; EEF2; DUSP9; ZFP36L1; ADRB2;
  1. What is the species homology for "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig, Rabbit, Sheep".

  2. How long will it take to receive "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAPK14 Antibody - C-terminal region (AVARP06004_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    This target may also be called "RK, p38, CSBP, EXIP, Mxi2, CSBP1, CSBP2, CSPB1, PRKM14, PRKM15, SAPK2A, p38ALPHA" in publications.

  5. What is the shipping cost for "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAPK14 Antibody - C-terminal region (AVARP06004_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAPK14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAPK14"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAPK14"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAPK14"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAPK14"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAPK14"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAPK14 Antibody - C-terminal region (AVARP06004_T100)
Your Rating
We found other products you might like!