MAPK11 Antibody - N-terminal region (ARP85386_P050)

Catalog No: ARP85386_P050

Host: Rabbit
Target Name: MAPK11
Sample Tissue: Human LN18 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N region of human MAPK11
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MAPK11 (ARP85386_P050) antibody is Catalog # AAP85386

Target Info

• Gene Symbol: MAPK11
• Gene Full Name: mitogen-activated protein kinase 11
• Alias Symbols: P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2
• NCBI Gene Id: 5600
• Protein Name: mitogen-activated protein kinase 11
• Description of Target: This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q16539-3
• Protein Accession #: NP_002742.3
• Nucleotide Accession #: NM_002751.6
• Protein Size (# AA): 297
• Molecular Weight: 32 kDa