Search Antibody, Protein, and ELISA Kit Solutions

MAPK11 Antibody - N-terminal region (ARP85386_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
mitogen-activated protein kinase 11
NCBI Gene Id:
Protein Name:
mitogen-activated protein kinase 11
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2
Description of Target:
This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The encoded protein can be activated by proinflammatory cytokines and environmental stresses through phosphorylation by mitogen activated protein kinase kinases (MKKs). Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
32 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAPK11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAPK11.
The immunogen is a synthetic peptide directed towards the N region of human MAPK11
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MAPK11 (ARP85386_P050) antibody is Catalog # AAP85386
Printable datasheet for anti-MAPK11 (ARP85386_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...