SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP85215_P050
Price: $0.00
SKU
ARP85215_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MAPK10 (ARP85215_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MAPK10
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: KMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTI
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAPK10 (ARP85215_P050) antibody is Catalog # AAP85215
Gene SymbolMAPK10
Gene Full Namemitogen-activated protein kinase 10
Alias SymbolsJNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
NCBI Gene Id5602
Protein Namemitogen-activated protein kinase 10
Description of TargetThe protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals and are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcription regulation and development. This kinase is specifically expressed in a subset of neurons in the nervous system and is activated by threonine and tyrosine phosphorylation. Targeted deletion of this gene in mice suggests that it may have a role in stress-induced neuronal apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. A recent study provided evidence for translational readthrough in this gene and expression of an additional C-terminally extended isoform via the use of an alternative in-frame translation termination codon.
Uniprot IDP53779-4
Protein Accession #NP_002744.1
Nucleotide Accession #NM_002753.3
Protein Size (# AA)277
Molecular Weight30 kDa
  1. What is the species homology for "MAPK10 Antibody - middle region (ARP85215_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MAPK10 Antibody - middle region (ARP85215_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "MAPK10 Antibody - middle region (ARP85215_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAPK10 Antibody - middle region (ARP85215_P050)"?

    This target may also be called "JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK" in publications.

  5. What is the shipping cost for "MAPK10 Antibody - middle region (ARP85215_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAPK10 Antibody - middle region (ARP85215_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAPK10 Antibody - middle region (ARP85215_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAPK10 Antibody - middle region (ARP85215_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAPK10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAPK10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAPK10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAPK10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAPK10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAPK10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAPK10 Antibody - middle region (ARP85215_P050)
Your Rating
We found other products you might like!