Search Antibody, Protein, and ELISA Kit Solutions

MAP4K2 Antibody - N-terminal region (ARP48631_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP48631_P050-FITC Conjugated

ARP48631_P050-HRP Conjugated

ARP48631_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-MAP4K2 (ARP48631_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MAP4K2 (ARP48631_P050) antibody is Catalog # AAP48631 (Previous Catalog # AAPY01605)
Datasheets/Manuals:
Printable datasheet for anti-MAP4K2 (ARP48631_P050) antibody
Target Reference:
Wissing,J., (2007) Mol. Cell Proteomics 6 (3), 537-547
Gene Symbol:
MAP4K2
Official Gene Full Name:
Mitogen-activated protein kinase kinase kinase kinase 2
Alias Symbols:
BL44, GCK, RAB8IP
NCBI Gene Id:
5871
Protein Name:
Mitogen-activated protein kinase kinase kinase kinase 2
Description of Target:
MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.The protein encoded by this gene is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.
Swissprot Id:
Q12851
Protein Accession #:
NP_004570
Nucleotide Accession #:
NM_004579
Protein Size (# AA):
820
Molecular Weight:
91kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP4K2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP4K2.
Protein Interactions:
HSP90AA1; UBC; MAP3K11; MAP3K1; POT1; MCM3AP-AS1; NACAD; SNRNP35; PRDX4; SERPINA4; HNRNPA2B1; XRCC6; DEFB1; TRAF2; RAB8A; MAP2K4;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...