Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48631_P050-FITC Conjugated

ARP48631_P050-HRP Conjugated

ARP48631_P050-Biotin Conjugated

MAP4K2 Antibody - N-terminal region (ARP48631_P050)

Catalog#: ARP48631_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-MAP4K2 (ARP48631_P050)
Peptide Sequence Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MAP4K2 (ARP48631_P050) antibody is Catalog # AAP48631 (Previous Catalog # AAPY01605)
Datasheets/Manuals Printable datasheet for anti-MAP4K2 (ARP48631_P050) antibody
Target Reference Wissing,J., (2007) Mol. Cell Proteomics 6 (3), 537-547
Gene Symbol MAP4K2
Official Gene Full Name Mitogen-activated protein kinase kinase kinase kinase 2
Alias Symbols BL44, GCK, RAB8IP
NCBI Gene Id 5871
Protein Name Mitogen-activated protein kinase kinase kinase kinase 2
Description of Target MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.The protein encoded by this gene is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.
Swissprot Id Q12851
Protein Accession # NP_004570
Nucleotide Accession # NM_004579
Protein Size (# AA) 820
Molecular Weight 91kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MAP4K2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MAP4K2.
  1. What is the species homology for "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAP4K2 Antibody - N-terminal region (ARP48631_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    This target may also be called "BL44, GCK, RAB8IP" in publications.

  5. What is the shipping cost for "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "91kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAP4K2 Antibody - N-terminal region (ARP48631_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MAP4K2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAP4K2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAP4K2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAP4K2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAP4K2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAP4K2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAP4K2 Antibody - N-terminal region (ARP48631_P050)
Your Rating
We found other products you might like!