MAP3K8 Antibody - C-terminal region (ARP30649_T100)

Catalog No: ARP30649_T100

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAP3K8
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-MAP3K8 (ARP30649_T100) antibody is Catalog # AAP30649 (Previous Catalog # AAPP01306)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: Jia,Y., et al., (2005) Arch. Biochem. Biophys. 441 (1), 64-74

Target Info

• Gene Symbol: MAP3K8
• Gene Full Name: Mitogen-activated protein kinase kinase kinase 8
• Alias Symbols: COT, EST, ESTF, TPL2, AURA2, MEKK8, Tpl-2, c-COT
• NCBI Gene Id: 1326
• Protein Name: Mitogen-activated protein kinase kinase kinase 8
• Description of Target: MAP3K8 is a member of the serine/threonine protein kinase family. This kinase can activate both the MAP kinase and JNK kinase pathways. This kinase was shown to activate IkappaB kinases, and thus induce the nuclear production of NF-kappaB. This kinase was also found to promote the production of TNF-alpha and IL-2 during T lymphocyte activation. Studies of a similar gene in rat suggested the direct involvement of this kinase in the proteolysis of NF-kappaB1,p105 (NFKB1). This gene may also utilize a downstream in-frame translation start codon, and thus produce an isoform containing a shorter N-terminus. The shorter isoform has been shown to display weaker transforming activity.
• Uniprot ID: P41279
• Protein Accession #: NP_005195
• Nucleotide Accession #: NM_005204
• Protein Size (# AA): 467
• Molecular Weight: 53kDa
• Protein Interactions: RELA; MAP2K1; RIPK1; NFKB1; ACY3; STIP1; HSP90AA1; TAB2; TRAF6; TRAF2; CD40; TNIP2; Nedd4; MAP3K14; MAP2K4; BMPR2; CHUK; REL; AKT1; NFKB2; KSR2;