Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP32402_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32402_P050-FITC Conjugated

ARP32402_P050-HRP Conjugated

ARP32402_P050-Biotin Conjugated

MAP3K7IP2 Antibody - N-terminal region (ARP32402_P050)

Catalog#: ARP32402_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-398188 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-MAP3K7IP2 (ARP32402_P050)
Peptide Sequence Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-TAB2 (ARP32402_P050) antibody is Catalog # AAP32402 (Previous Catalog # AAPP03393)
Datasheets/Manuals Printable datasheet for anti-TAB2 (ARP32402_P050) antibody
Sample Type Confirmation

TAB2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Kanayama, A., et al., ,(2004) Mol. Cell 15 (4), 535-548
Publications

Thienpont, B. et al. Haploinsufficiency of TAB2 causes congenital heart defects in humans. Am. J. Hum. Genet. 86, 839-49 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20493459

Gene Symbol TAB2
Official Gene Full Name TGF-beta activated kinase 1/MAP3K7 binding protein 2
Alias Symbols CHTD2, MAP3K7IP2
NCBI Gene Id 23118
Protein Name TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
Description of Target MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.
Swissprot Id Q9NYJ8
Protein Accession # NP_055908
Nucleotide Accession # NM_015093
Protein Size (# AA) 693
Molecular Weight 76kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MAP3K7IP2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MAP3K7IP2.
Protein Interactions UBC; PIAS3; UBE2I; TRAF6; SUMO2; IRAK1; MAP3K7; TRIM38; SIK1; SIK3; TRIM22; NPM1; CST9L; SLC19A3; env; TAB1; NUMBL; IKBKG; FOSL1; ZBTB16; YWHAZ; VIM; TGM2; PPP2CB; IKBKB; GTF2I; FN1; HSP90AA1; BST2; MALT1; WDR34; APP; ESR1; MAP3K8; AR; TRIM5; TBL1XR1; MBD
Write Your Own Review
You're reviewing:MAP3K7IP2 Antibody - N-terminal region (ARP32402_P050)
Your Rating