Search Antibody, Protein, and ELISA Kit Solutions

MAP3K7IP2 antibody - N-terminal region (ARP32402_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32402_P050-FITC Conjugated

ARP32402_P050-HRP Conjugated

ARP32402_P050-Biotin Conjugated

Gene Symbol:
TAB2
NCBI Gene Id:
23118
Official Gene Full Name:
TGF-beta activated kinase 1/MAP3K7 binding protein 2
Protein Name:
TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
Swissprot Id:
Q9NYJ8
Protein Accession #:
NP_055908
Nucleotide Accession #:
NM_015093
Alias Symbols:
CHTD2, MAP3K7IP2
Replacement Item:
This antibody may replace item sc-398188 from Santa Cruz Biotechnology.
Description of Target:
MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.
Protein Size (# AA):
693
Molecular Weight:
76kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP3K7IP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP3K7IP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MAP3K7IP2 (ARP32402_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PIAS3; UBE2I; TRAF6; SUMO2; IRAK1; MAP3K7; TRIM38; SIK1; SIK3; TRIM22; NPM1; CST9L; SLC19A3; env; TAB1; NUMBL; IKBKG; FOSL1; ZBTB16; YWHAZ; VIM; TGM2; PPP2CB; IKBKB; GTF2I; FN1; HSP90AA1; BST2; MALT1; WDR34; APP; ESR1; MAP3K8; AR; TRIM5; TBL1XR1; MBD
Blocking Peptide:
For anti-TAB2 (ARP32402_P050) antibody is Catalog # AAP32402 (Previous Catalog # AAPP03393)
Datasheets/Manuals:
Printable datasheet for anti-TAB2 (ARP32402_P050) antibody
Sample Type Confirmation:

TAB2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Kanayama, A., et al., ,(2004) Mol. Cell 15 (4), 535-548
Publications:

Thienpont, B. et al. Haploinsufficiency of TAB2 causes congenital heart defects in humans. Am. J. Hum. Genet. 86, 839-49 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20493459

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...