MAP2K3 Recombinant Protein (Human) (OPCA03899)

Catalog No: OPCA03899

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
• Protein Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-347 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012)

Target Info

• Gene Symbol: MAP2K3
• Gene Full Name: mitogen-activated protein kinase kinase 3
• Alias Symbols: dual specificity mitogen-activated protein kinase kinase 3;MAP kinase kinase 3;MAPK/ERK kinase 3;MAPKK 3;MAPKK3;MEK 3;MEK3;MKK3;PRKMK3;SAPK kinase 2;SAPKK2;SAPKK-2;stress-activated protein kinase kinase 2.
• NCBI Gene Id: 5606
• Protein Name: Dual specificity mitogen-activated protein kinase kinase 3
• Description of Target: Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14.
• Uniprot ID: P46734
• Protein Accession #: NP_001303261
• Nucleotide Accession #: NM_001316332
• Protein Size (# AA): Recombinant
• Molecular Weight: 55.3 kDa