Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MAP2K3 antibody - C-terminal region (ARP42065_P050)

100 ul
In Stock

Conjugation Options

ARP42065_P050-FITC Conjugated

ARP42065_P050-HRP Conjugated

ARP42065_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mitogen-activated protein kinase kinase 3
Protein Name:
Dual specificity mitogen-activated protein kinase kinase 3
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-135985 from Santa Cruz Biotechnology.
Description of Target:
MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP2K3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP2K3.
The immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K3
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Complete computational species homology data:
Anti-MAP2K3 (ARP42065_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MAP2K3 (ARP42065_P050) antibody is Catalog # AAP42065 (Previous Catalog # AAPP24544)
Printable datasheet for anti-MAP2K3 (ARP42065_P050) antibody
Sample Type Confirmation:

MAP2K3 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Prickett,T.D. (2007) Mol. Cell. Biol. 27 (12), 4217-4227

Tell us what you think about this item!

Write A Review
    Please, wait...