SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48942_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP48942_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-MAP2K2 (ARP48942_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAP2K2 (ARP48942_P050-HRP) antibody is Catalog # AAP48942 (Previous Catalog # AAPP28989)
Sample Type Confirmation

There is BioGPS gene expression data showing that MAP2K2 is expressed in HepG2

ReferenceAdjei,A.A., (2008) J. Clin. Oncol. 26 (13), 2139-2146
Gene SymbolMAP2K2
Gene Full NameMitogen-activated protein kinase kinase 2
Alias SymbolsCFC4, MEK2, MKK2, MAPKK2, PRKMK2
NCBI Gene Id5605
Protein NameDual specificity mitogen-activated protein kinase kinase 2
Description of TargetMAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP36507
Protein Accession #NP_109587
Nucleotide Accession #NM_030662
Protein Size (# AA)400
Molecular Weight44kDa
Protein InteractionsCCNDBP1; RAF1; SUMO2; UBC; EGFR; IQGAP1; NFE2L2; YWHAB; MAPK1; PEX14; BRAF; ARAF; FAM65B; ZNF207; LIG4; MAPK8; WDR83; Ksr1; COPS5; MAP2K1; MEPCE; GRIN1; CNKSR1; LAMTOR3; GRIN2D; RGS12; CASP9; MAPK3; MAP2K2; DUSP3; Flna;
  1. What is the species homology for "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig".

  2. How long will it take to receive "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    This target may also be called "CFC4, MEK2, MKK2, MAPKK2, PRKMK2" in publications.

  5. What is the shipping cost for "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAP2K2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAP2K2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAP2K2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAP2K2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAP2K2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAP2K2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAP2K2 Antibody - C-terminal region : HRP (ARP48942_P050-HRP)
Your Rating
We found other products you might like!