Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MAP2K2 antibody - C-terminal region (ARP48942_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP48942_P050-FITC Conjugated

ARP48942_P050-HRP Conjugated

ARP48942_P050-Biotin Conjugated

Gene Symbol:
MAP2K2
NCBI Gene Id:
5605
Official Gene Full Name:
Mitogen-activated protein kinase kinase 2
Protein Name:
Dual specificity mitogen-activated protein kinase kinase 2
Swissprot Id:
P36507
Protein Accession #:
NP_109587
Nucleotide Accession #:
NM_030662
Alias Symbols:
MAPKK2, MEK2, MKK2, PRKMK2
Replacement Item:
This antibody may replace item sc-136261 from Santa Cruz Biotechnology.
Description of Target:
MAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
400
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP2K2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP2K2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rat: 92%
Complete computational species homology data:
Anti-MAP2K2 (ARP48942_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCNDBP1; RAF1; SUMO2; UBC; EGFR; IQGAP1; NFE2L2; YWHAB; MAPK1; PEX14; BRAF; ARAF; FAM65B; ZNF207; LIG4; MAPK8; WDR83; Ksr1; COPS5; MAP2K1; MEPCE; GRIN1; CNKSR1; LAMTOR3; GRIN2D; RGS12; CASP9; MAPK3; MAP2K2; DUSP3; Flna;
Blocking Peptide:
For anti-MAP2K2 (ARP48942_P050) antibody is Catalog # AAP48942 (Previous Catalog # AAPP28989)
Datasheets/Manuals:
Printable datasheet for anti-MAP2K2 (ARP48942_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that MAP2K2 is expressed in HepG2

Target Reference:
Adjei,A.A., (2008) J. Clin. Oncol. 26 (13), 2139-2146

Tell us what you think about this item!

Write A Review
    Please, wait...