Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

MAP2 Antibody - N-terminal region : FITC (ARP72521_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72521_P050 Unconjugated

ARP72521_P050-HRP Conjugated

ARP72521_P050-Biotin Conjugated

Gene Symbol:
MAP2
NCBI Gene Id:
4133
Swissprot Id:
P11137
Alias Symbols:
MAP2,
Replacement Item:
This antibody may replace item sc-12012 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.
Protein Size (# AA):
1827
Molecular Weight:
200kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MAP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MAP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAP2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
EIF3K; DIMT1; HNRNPA0; IGF2BP3; EIF3C; RPL23A; PSMD13; PSMD8; PSMC5; PA2G4; YBX1; NMT1; DYNC1I2; DHX9; ABCF1; HECW2; JUNB; ACTB; APP; RAE1; TUBA1A; ACTN1; MARK3; Nedd4; NEDD4L; UBC; DAG1; GRIN1; TTBK1; CPEB1; MARK4; MARK1; GRIN2D; PRKACA; PAFAH1B1; PLEC;
Blocking Peptide:
For anti-MAP2 (ARP72521_P050-FITC) antibody is Catalog # AAP72521
Datasheets/Manuals:
Printable datasheet for anti-MAP2 (ARP72521_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...