$0.00
In stock
SKU
OPCA277877
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MAP1LC3A Recombinant Protein (Rat) (OPCA277877)

Catalog#: OPCA277877
Domestic: within 4-6 weeks delivery International: 4-6 weeks
More Information
Predicted Species Reactivity Rat
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA277877
Gene Symbol MAP1LC3A
Official Gene Full Name microtubule-associated protein 1 light chain 3 alpha
Alias Symbols LC3A, LC3-I, LC3-II
NCBI Gene Id 362245
Protein Name microtubule-associated proteins 1A/1B light chain 3A
Description of Target light chain subunit of MAP1A and MAP1B microtubule-associated proteins; mediates interactions between microtubules and the cytoskeleton [RGD, Feb 2006]
Swissprot Id Q6XVN8
Protein Accession # NP_955794.1
Nucleotide Accession # NM_199500.2
Protein Size (# AA) 120
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MAP1LC3A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MAP1LC3A.
Write Your Own Review
You're reviewing:MAP1LC3A Recombinant Protein (Rat) (OPCA277877)
Your Rating