Search Antibody, Protein, and ELISA Kit Solutions

MALT1 Antibody - middle region : FITC (ARP72591_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72591_P050 Unconjugated

ARP72591_P050-HRP Conjugated

ARP72591_P050-Biotin Conjugated

Gene Symbol:
MALT1
NCBI Gene Id:
10892
Swissprot Id:
Q9UDY8
Alias Symbols:
MALT1, MLT,
Replacement Item:
This antibody may replace item sc-130494 from Santa Cruz Biotechnology.
Description of Target:
This gene has been found to be recurrently rearranged in chromosomal translocation with two other genes - baculoviral IAP repeat-containing protein 3 (also known as apoptosis inhibitor 2) and immunoglobulin heavy chain locus - in mucosa-associated lymphoid tissue lymphomas. The protein encoded by this gene may play a role in NF-kappaB activation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein Size (# AA):
824
Molecular Weight:
90kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MALT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MALT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human MALT1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: YWCHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
BCL10; IKBKG; UBE2V2; UBE2N; UBC; RNF31; SUMO1; TNFAIP3; PRMT6; KDM1A; CARM1; SUV39H1; USP9X; PRKCQ; DAB2; MALT1; SQSTM1; CARD11; HECTD3; TAB2; STUB1; USP2; TRAF6; MAP3K7; DIABLO; TRAF2; RELB; CAMK2G; COPS5; GPS1; NFKBIA; CSNK1A1; UBE2G2; UBB;
Blocking Peptide:
For anti-MALT1 (ARP72591_P050-FITC) antibody is Catalog # AAP72591
Datasheets/Manuals:
Printable datasheet for anti-MALT1 (ARP72591_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...