MAJOR POLLEN ALLERGEN ALN G 1 Recombinant Protein (European alder) (OPCA04322)

Catalog No: OPCA04322

Product Info

• Predicted Species Reactivity: Alnus glutinosa
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: European alder
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
• Protein Sequence: GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 2-160 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Complementary DNA cloning and expression in Escherichia coli of Aln g I, the major allergen in pollen of alder (Alnus glutinosa). Breiteneder H., Ferreira F., Reikerstorfer A., Duchene M., Valenta R., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Kraft D., Scheiner O.J. Allergy Clin. Immunol. 90:909-917(1992)

Target Info

• Alias Symbols: Allergen Aln g I.
• Protein Name: Major pollen allergen Aln g 1
• Uniprot ID: P38948
• Protein Size (# AA): Recombinant
• Molecular Weight: 19.2 kDa