Major pepsin inhibitor 3 Recombinant Protein (Pig roundworm) (OPCA03219)

Catalog No: OPCA03219

Pepsin inhibitor 3 Recombinant Protein (Ascaris suum) (OPCA03219) in SDS-PAGE showing the molecular weight of approximately 32.39 kDa.

Product Info

• Predicted Species Reactivity: Ascaris suum
• Product Format: Liquid or Lyophilized powder
• Host: Ascaris suum
• Additional Information: Relevance: This is an inhibitor of the aspartic protease pepsin.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
• Protein Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 21-169 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Molecular cloning, expression and characterization of an Ascaris inhibitor for pepsin and cathepsin E.Kageyama T.Eur. J. Biochem. 253:804-809(1998)
• Alias Symbols: PI-3
• Protein Name: Major pepsin inhibitor 3
• Description of Target: This is an inhibitor of the aspartic protease pepsin.
• Uniprot ID: P19400
• Protein Size (# AA): Recombinant
• Molecular Weight: 32.4 kDa